Homologs in group_2208

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16895 FBDBKF_16895 71.2 Morganella morganii S1 fre NAD(P)H-flavin reductase
EHELCC_19535 EHELCC_19535 71.2 Morganella morganii S2 fre NAD(P)H-flavin reductase
NLDBIP_16905 NLDBIP_16905 71.2 Morganella morganii S4 fre NAD(P)H-flavin reductase
LHKJJB_16565 LHKJJB_16565 71.2 Morganella morganii S3 fre NAD(P)H-flavin reductase
HKOGLL_17530 HKOGLL_17530 71.2 Morganella morganii S5 fre NAD(P)H-flavin reductase
F4V73_RS18365 F4V73_RS18365 70.0 Morganella psychrotolerans fre NAD(P)H-flavin reductase

Distribution of the homologs in the orthogroup group_2208

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2208

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P43129 3.89e-125 357 70 0 233 3 fre NAD(P)H-flavin reductase Photorhabdus luminescens
Q9L6L9 8.12e-120 343 67 0 233 1 fre NAD(P)H-flavin reductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AEN1 7.51e-119 340 67 0 233 1 fre NAD(P)H-flavin reductase Escherichia coli (strain K12)
P0AEN2 7.51e-119 340 67 0 233 3 fre NAD(P)H-flavin reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEN3 7.51e-119 340 67 0 233 3 fre NAD(P)H-flavin reductase Escherichia coli O157:H7
P43127 1.54e-79 241 49 3 235 1 fre NAD(P)H-flavin reductase Vibrio harveyi
P43126 1.24e-76 234 49 4 235 3 fre NAD(P)H-flavin reductase Aliivibrio fischeri
P29237 1.23e-60 193 39 2 233 3 luxG Probable flavin reductase Photobacterium leiognathi
P16447 3.78e-58 186 40 2 232 3 luxG Probable flavin reductase Vibrio harveyi
P24273 1.91e-56 182 40 2 227 3 luxG Probable flavin reductase Aliivibrio fischeri
P43128 7.51e-48 158 46 2 163 3 fre NAD(P)H-flavin reductase (Fragment) Vibrio orientalis
P68641 1.69e-31 120 31 5 227 3 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pestis
Q66DP5 2.8e-31 120 31 5 227 1 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q52126 1.32e-25 105 29 2 228 1 ndoR Naphthalene 1,2-dioxygenase system ferredoxin--NAD(P)(+), reductase component Pseudomonas putida
P26395 2.36e-23 99 30 6 230 4 rfbI Protein RfbI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7WTJ2 7.69e-23 98 29 4 227 1 mphP Phenol hydroxylase P5 protein Acinetobacter pittii (strain PHEA-2)
P19734 3.23e-21 93 29 4 230 1 dmpP Phenol 2-monooxygenase, reductase component DmpP Pseudomonas sp. (strain CF600)
O52378 4.2e-20 90 28 3 207 1 nagAa Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin--NAD(P)(+), reductase component Ralstonia sp.
Q3C1E0 7.95e-20 89 29 3 199 1 tphA1I Terephthalate 1,2-dioxygenase, reductase component 1 Comamonas sp.
Q45692 1.05e-19 89 26 1 220 1 dntAa 2,4-dinitrotoluene dioxygenase system ferredoxin--NAD(+), reductase component Burkholderia sp. (strain RASC)
Q3C1D2 1.63e-19 88 29 3 199 1 tphA1II Terephthalate 1,2-dioxygenase, reductase component 2 Comamonas sp.
Q768T4 1.33e-18 86 26 5 234 1 prmB Propane 2-monooxygenase, reductase component Gordonia sp. (strain TY-5)
P0DPQ8 8.98e-16 78 29 8 237 1 gcoB Aromatic O-demethylase, reductase subunit Amycolatopsis sp. (strain ATCC 39116 / 75iv2)
A7IPX7 1.49e-14 74 26 1 225 1 xamoF Alkene monooxygenase system, ferredoxin--NAD(+) reductase component Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q8GI14 7.76e-14 72 26 6 233 1 carAd Ferredoxin--NAD(P)(+) reductase CarAd Pseudomonas resinovorans
O85675 1.91e-12 68 25 2 175 1 antC Anthranilate 1,2-dioxygenase electron transfer component Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
E9RFT0 1.6e-11 66 22 4 232 1 mimB Propane 2-monooxygenase, reductase component Mycolicibacterium goodii
Q0SJK8 3.55e-11 65 21 4 232 1 prmB Propane 2-monooxygenase, reductase component Rhodococcus jostii (strain RHA1)
A0QTU9 6.67e-11 64 23 5 232 1 mimB Propane 2-monooxygenase, reductase component Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P21394 1.18e-10 63 22 6 217 1 xylA Xylene/toluene monooxygenase electron transfer component XylA Pseudomonas putida
Q51603 1.46e-10 63 27 6 199 1 cbdC 2-halobenzoate 1,2-dioxygenase electron transfer component Burkholderia cepacia
P22868 8.21e-09 58 23 3 202 1 mmoC Methane monooxygenase component C Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
P07771 2.44e-08 57 26 7 207 1 benC Benzoate 1,2-dioxygenase electron transfer component Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q7WUM8 1.73e-06 51 24 9 221 3 hmp Flavohemoprotein Rhizobium meliloti (strain 1021)
A9FRJ0 2.93e-06 50 23 4 217 1 sce5135 Ferredoxin--NADP reductase B Sorangium cellulosum (strain So ce56)
Q9X406 2.94e-06 50 26 3 165 1 msmD Putative methanesulfonate monooxygenase ferredoxin reductase subunit Methylosulfonomonas methylovora
A6VW13 3.45e-06 50 23 6 166 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Marinomonas sp. (strain MWYL1)
Q03304 4.36e-06 50 22 3 217 1 tmoF Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component Pseudomonas mendocina
Q9LCJ4 7.36e-06 49 22 5 165 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F (Fragment) Pseudoalteromonas haloplanktis
A8GAC4 9.87e-06 49 24 5 164 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Serratia proteamaculans (strain 568)
P39662 1.63e-05 48 23 8 221 1 hmp Flavohemoprotein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q53563 2.1e-05 48 22 6 202 1 mmoC Methane monooxygenase component C Methylosinus trichosporium
Q9K0M8 2.43e-05 48 23 5 166 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1KSH3 2.47e-05 48 23 5 166 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JVQ3 2.47e-05 48 23 5 166 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M2A6 2.47e-05 48 23 5 166 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup C (strain 053442)
P76081 2.75e-05 47 27 5 139 1 paaE 1,2-phenylacetyl-CoA epoxidase, subunit E Escherichia coli (strain K12)
Q5QYQ8 3.15e-05 47 23 5 161 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q9LCI9 3.19e-05 47 22 5 161 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F (Fragment) Moritella marina
B6V6V6 9.37e-05 46 27 6 165 1 kshB 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Rhodococcus rhodochrous
C8VJR5 0.000109 46 27 8 207 2 alnC NADH-cytochrome b5 reductase-like protein alnC Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q9LCI8 0.000114 45 21 5 165 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F (Fragment) Shewanella hanedai
Q9LCJ3 0.000138 45 23 6 162 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F (Fragment) Alteromonas macleodii
Q4FPV2 0.000256 45 20 5 165 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q9LCJ2 0.000266 44 23 6 162 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F (Fragment) Colwellia psychrerythraea
Q1Q7Z7 0.000387 44 20 5 165 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q5F6X5 0.000388 44 22 5 166 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q15YQ1 0.000426 44 24 6 162 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17630
Feature type CDS
Gene fre
Product NAD(P)H-flavin reductase
Location 3867952 - 3868653 (strand: 1)
Length 702 (nucleotides) / 233 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2208
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00175 Oxidoreductase NAD-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0543 Coenzyme transport and metabolism (H)
Energy production and conversion (C)		 HC NAD(P)H-flavin reductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05368 NAD(P)H-flavin reductase [EC:1.5.1.41] Riboflavin metabolism
Metabolic pathways		 -

Protein Sequence

MAILNCKVSLVEPITDTVYRVRLLPDGPFDFQAGQYLLAVMDERDKRPFSIASIPENKDFIELHIGASDLNLYAMAVLDLILETQQLKIDIPHGNAWFRQQSQRPLLLIAGGTGFSYTHSILLAALQENPQRAITLYWGGREQVHLYDLNELQDLTEKYPSLSVVPVVEQPDDAWRGRKGTVLTAISEDFGDLSSYDIYIAGRFEMAKIARDRFCNERNADRERLFSDAFEFI

Flanking regions ( +/- flanking 50bp)

ATACTATTTGGGAACAGCTCGATATTGTTAAATAATAATAGAGGAACAACATGGCGATACTGAACTGTAAAGTCTCACTCGTTGAGCCGATAACAGATACGGTGTATCGGGTAAGATTATTACCTGATGGCCCATTTGATTTTCAGGCTGGACAATACCTTTTAGCGGTTATGGATGAGCGAGATAAGCGCCCATTCTCTATTGCCTCTATTCCCGAAAATAAAGACTTTATTGAGCTTCATATTGGCGCGTCAGATCTGAATCTTTACGCAATGGCTGTGCTCGATCTTATTTTAGAAACTCAACAATTAAAGATTGATATTCCCCATGGTAATGCGTGGTTTAGACAACAGAGCCAACGTCCTTTGTTGCTTATCGCAGGAGGAACAGGATTTTCTTATACTCACTCTATCTTGCTAGCGGCATTACAAGAAAATCCTCAACGTGCGATAACGCTTTATTGGGGAGGACGAGAGCAGGTACATCTTTATGATCTTAATGAGTTGCAAGATTTAACGGAAAAGTATCCCTCATTATCAGTCGTACCTGTTGTTGAACAACCTGATGACGCTTGGCGTGGTAGAAAAGGGACTGTATTAACGGCAATTAGTGAAGATTTTGGCGATTTATCATCCTATGATATTTATATCGCAGGACGTTTTGAAATGGCTAAAATAGCGCGAGATCGTTTTTGTAATGAGCGTAATGCTGATAGAGAACGCTTATTTAGTGATGCTTTTGAGTTTATTTAATAAGCAATAACGATAAAAAAACCATAAAAAAACCATAAAAAAACCATAAA