Homologs in group_342

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11810 FBDBKF_11810 42.7 Morganella morganii S1 murQ N-acetylmuramic acid 6-phosphate etherase
EHELCC_14495 EHELCC_14495 42.7 Morganella morganii S2 murQ N-acetylmuramic acid 6-phosphate etherase
NLDBIP_15590 NLDBIP_15590 42.7 Morganella morganii S4 murQ N-acetylmuramic acid 6-phosphate etherase
LHKJJB_15020 LHKJJB_15020 42.7 Morganella morganii S3 murQ N-acetylmuramic acid 6-phosphate etherase
HKOGLL_14140 HKOGLL_14140 42.7 Morganella morganii S5 murQ N-acetylmuramic acid 6-phosphate etherase
F4V73_RS14845 F4V73_RS14845 43.7 Morganella psychrotolerans murQ N-acetylmuramic acid 6-phosphate etherase
PMI_RS15530 PMI_RS15530 43.7 Proteus mirabilis HI4320 murQ N-acetylmuramic acid 6-phosphate etherase

Distribution of the homologs in the orthogroup group_342

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_342

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A6LUQ7 4.68e-97 291 53 2 271 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B0K1N2 5.9e-91 275 50 0 275 3 murQ N-acetylmuramic acid 6-phosphate etherase Thermoanaerobacter sp. (strain X514)
C3KUL4 2.99e-90 273 48 0 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain 657 / Type Ba4)
B1IK79 1.03e-89 272 48 0 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain Okra / Type B1)
A7GD48 1.51e-89 272 48 0 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A6TVQ2 4.15e-89 271 51 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Alkaliphilus metalliredigens (strain QYMF)
C1FLJ7 1.04e-88 270 48 0 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain Kyoto / Type A2)
A5I1H8 1.04e-88 270 48 0 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FTM1 1.04e-88 270 48 0 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain ATCC 19397 / Type A)
B1L0G9 1.03e-87 267 47 0 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain Loch Maree / Type A3)
Q87S81 9.96e-87 265 49 0 281 3 murQ1 N-acetylmuramic acid 6-phosphate etherase 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7N9D8 1.55e-86 264 47 0 276 3 murQ N-acetylmuramic acid 6-phosphate etherase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q184N3 8.69e-86 262 48 0 275 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridioides difficile (strain 630)
B8F4V1 1.4e-85 262 48 0 281 3 murQ N-acetylmuramic acid 6-phosphate etherase Glaesserella parasuis serovar 5 (strain SH0165)
Q97MM1 2.79e-85 261 45 0 272 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B6EJZ8 5.02e-85 260 48 1 273 3 murQ N-acetylmuramic acid 6-phosphate etherase Aliivibrio salmonicida (strain LFI1238)
Q65R16 1.41e-84 259 46 0 286 3 murQ N-acetylmuramic acid 6-phosphate etherase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
C5DAG6 1.49e-84 259 47 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Geobacillus sp. (strain WCH70)
Q6LL16 2.95e-84 258 47 1 286 3 murQ N-acetylmuramic acid 6-phosphate etherase Photobacterium profundum (strain SS9)
P44862 3.11e-84 258 47 0 286 1 murQ N-acetylmuramic acid 6-phosphate etherase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q87FD6 3.63e-84 258 46 2 303 3 murQ2 N-acetylmuramic acid 6-phosphate etherase 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q0I1F8 5.02e-84 258 48 0 266 3 murQ N-acetylmuramic acid 6-phosphate etherase Histophilus somni (strain 129Pt)
B7VJM5 1.47e-83 256 48 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Vibrio atlanticus (strain LGP32)
Q5E5T7 1.74e-83 256 47 1 273 3 murQ N-acetylmuramic acid 6-phosphate etherase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B0UW11 1.81e-83 256 48 0 266 3 murQ N-acetylmuramic acid 6-phosphate etherase Histophilus somni (strain 2336)
B5FDJ8 1.83e-83 256 47 1 273 3 murQ N-acetylmuramic acid 6-phosphate etherase Aliivibrio fischeri (strain MJ11)
B1JRW1 4.69e-83 255 45 1 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667V7 4.69e-83 255 45 1 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TMY1 4.69e-83 255 45 1 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pestis (strain Pestoides F)
Q1CKD6 4.69e-83 255 45 1 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R410 4.69e-83 255 45 1 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZCP8 4.69e-83 255 45 1 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pestis
B2KA40 4.69e-83 255 45 1 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C5E3 4.69e-83 255 45 1 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFU6 4.69e-83 255 45 1 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4WDD1 1.26e-82 254 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Enterobacter sp. (strain 638)
Q8GC81 1.33e-82 254 45 0 281 3 murQ N-acetylmuramic acid 6-phosphate etherase Klebsiella aerogenes
Q838I8 1.72e-82 254 47 0 272 3 murQ1 N-acetylmuramic acid 6-phosphate etherase 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8RD35 2.27e-82 254 46 0 274 3 murQ N-acetylmuramic acid 6-phosphate etherase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q7MBS3 2.19e-81 251 47 1 290 3 murQ N-acetylmuramic acid 6-phosphate etherase Vibrio vulnificus (strain YJ016)
Q8D4Z4 2.19e-81 251 47 1 290 3 murQ N-acetylmuramic acid 6-phosphate etherase Vibrio vulnificus (strain CMCP6)
A7MTC9 3.81e-81 251 47 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Vibrio campbellii (strain ATCC BAA-1116)
Q9KU39 6.22e-81 250 47 1 285 3 murQ2 N-acetylmuramic acid 6-phosphate etherase 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B2VEB1 6.22e-81 250 46 1 279 3 murQ N-acetylmuramic acid 6-phosphate etherase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4IPI2 6.73e-81 249 45 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Geobacillus thermodenitrificans (strain NG80-2)
C5BBH3 8.05e-81 249 47 0 276 3 murQ N-acetylmuramic acid 6-phosphate etherase Edwardsiella ictaluri (strain 93-146)
Q45582 4.65e-80 248 47 0 259 1 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus subtilis (strain 168)
Q65P54 7.58e-80 247 44 0 289 3 murQ1 N-acetylmuramic acid 6-phosphate etherase 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A3N2I4 1.12e-79 247 45 1 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q1R8U4 1.82e-79 246 44 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain UTI89 / UPEC)
A1ADU3 1.82e-79 246 44 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O1:K1 / APEC
B7MHT0 1.82e-79 246 44 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7LKK7 2.52e-79 246 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A6VKY9 3.7e-79 245 44 1 296 3 murQ N-acetylmuramic acid 6-phosphate etherase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q8FFB0 4.25e-79 245 44 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TF40 4.25e-79 245 44 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MY79 4.25e-79 245 44 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O81 (strain ED1a)
Q3YZB4 5.11e-79 245 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Shigella sonnei (strain Ss046)
Q7UNL6 5.54e-79 245 44 0 273 3 murQ N-acetylmuramic acid 6-phosphate etherase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
P76535 6.85e-79 244 47 0 260 1 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain K12)
B1IX44 6.85e-79 244 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A2S5 6.85e-79 244 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O9:H4 (strain HS)
B1XA99 6.85e-79 244 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain K12 / DH10B)
C4ZVV9 6.85e-79 244 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain K12 / MC4100 / BW2952)
Q28KP2 7.04e-79 245 46 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Jannaschia sp. (strain CCS1)
B1LMM2 7.55e-79 244 44 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain SMS-3-5 / SECEC)
B7N618 8.33e-79 244 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7UGC8 8.33e-79 244 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B6I504 1.13e-78 244 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain SE11)
B7M6T7 1.13e-78 244 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O8 (strain IAI1)
B7LCH2 1.13e-78 244 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain 55989 / EAEC)
A7ZPM8 1.13e-78 244 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O139:H28 (strain E24377A / ETEC)
A1STT9 1.22e-78 244 48 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q31Y51 1.26e-78 244 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Shigella boydii serotype 4 (strain Sb227)
B2TX17 1.26e-78 244 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q32DC6 1.31e-78 244 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Shigella dysenteriae serotype 1 (strain Sd197)
A7Z0U6 1.32e-78 244 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q0T280 1.72e-78 243 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Shigella flexneri serotype 5b (strain 8401)
Q67RV4 1.96e-78 243 52 1 257 3 murQ N-acetylmuramic acid 6-phosphate etherase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B3GYL8 2.12e-78 243 45 1 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B5YZX3 2.19e-78 243 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XBJ2 2.19e-78 243 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O157:H7
B7NPW4 2.26e-78 243 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P57951 2.48e-78 243 47 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Pasteurella multocida (strain Pm70)
Q9KVE0 2.74e-78 243 45 2 293 3 murQ1 N-acetylmuramic acid 6-phosphate etherase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q83QN4 2.93e-78 243 47 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Shigella flexneri
B2TPW8 3.79e-78 243 49 0 250 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain Eklund 17B / Type B)
B0BRD0 4.21e-78 243 47 0 269 3 murQ N-acetylmuramic acid 6-phosphate etherase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
C4KZ07 7.5e-78 242 43 0 275 3 murQ N-acetylmuramic acid 6-phosphate etherase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B9JJJ9 2.15e-77 241 46 0 274 3 murQ N-acetylmuramic acid 6-phosphate etherase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q986Q8 2.27e-77 241 46 0 276 3 murQ N-acetylmuramic acid 6-phosphate etherase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q88SC3 3.75e-77 240 43 1 289 3 murQ1 N-acetylmuramic acid 6-phosphate etherase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A6X3M9 2.29e-76 238 43 0 280 3 murQ N-acetylmuramic acid 6-phosphate etherase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q6MTZ7 3.61e-76 238 43 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q88SB0 5.04e-76 237 46 0 265 3 murQ2 N-acetylmuramic acid 6-phosphate etherase 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q81HH1 5.76e-76 237 45 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A0KFC0 5.85e-76 237 44 0 283 3 murQ N-acetylmuramic acid 6-phosphate etherase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q4L8H4 6.41e-76 237 45 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus haemolyticus (strain JCSC1435)
B5F1F1 6.89e-76 237 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella agona (strain SL483)
Q8Z4L2 7.2e-76 237 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella typhi
Q6D234 7.69e-76 237 46 1 279 3 murQ N-acetylmuramic acid 6-phosphate etherase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B7II82 1.92e-75 236 45 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain G9842)
Q8ZN25 2.95e-75 235 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BAU0 2.95e-75 235 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella paratyphi A (strain AKU_12601)
Q5PII8 2.95e-75 235 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T1E8 2.95e-75 235 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella newport (strain SL254)
B4TDE5 2.95e-75 235 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella heidelberg (strain SL476)
Q6HMZ5 3.13e-75 235 45 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus thuringiensis subsp. konkukian (strain 97-27)
B4TS04 3.4e-75 235 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella schwarzengrund (strain CVM19633)
B5RD39 3.4e-75 235 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QTT8 3.4e-75 235 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella enteritidis PT4 (strain P125109)
B5FRB5 3.4e-75 235 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella dublin (strain CT_02021853)
Q57LE0 3.43e-75 235 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella choleraesuis (strain SC-B67)
B7JSA1 6.26e-75 234 45 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain AH820)
B7HER4 6.33e-75 234 45 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain B4264)
B9IR64 7.53e-75 234 45 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain Q1)
B7HXH0 7.53e-75 234 45 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain AH187)
Q81UP1 7.53e-75 234 44 1 275 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus anthracis
C3LE93 7.53e-75 234 44 1 275 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P1J8 7.53e-75 234 44 1 275 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus anthracis (strain A0248)
Q73D01 8.13e-75 234 44 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain ATCC 10987 / NRS 248)
A7GLK9 9.67e-75 234 45 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A9N1U1 9.94e-75 234 49 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q63FJ0 1.04e-74 234 45 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain ZK / E33L)
A0QNX1 1.47e-74 233 44 1 281 3 murQ N-acetylmuramic acid 6-phosphate etherase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
C1EYT0 2.09e-74 233 45 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain 03BB102)
A9VGE7 5.48e-74 232 44 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus mycoides (strain KBAB4)
A7MGZ1 5.51e-74 232 47 0 259 3 murQ N-acetylmuramic acid 6-phosphate etherase Cronobacter sakazakii (strain ATCC BAA-894)
Q2JMP1 7.53e-74 232 47 0 280 3 murQ N-acetylmuramic acid 6-phosphate etherase Synechococcus sp. (strain JA-2-3B'a(2-13))
A8F9E0 7.88e-74 232 45 0 261 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus pumilus (strain SAFR-032)
A0AJB3 1.04e-73 231 45 0 261 3 murQ N-acetylmuramic acid 6-phosphate etherase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q9K6Z9 1.14e-73 231 44 2 284 3 murQ N-acetylmuramic acid 6-phosphate etherase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5FIF8 2.16e-73 230 43 0 278 3 murQ N-acetylmuramic acid 6-phosphate etherase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q7A1Y2 3.51e-73 230 44 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain MW2)
Q6GCT5 3.51e-73 230 44 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain MSSA476)
Q6GKB5 3.51e-73 230 44 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain MRSA252)
Q7A805 3.51e-73 230 44 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain N315)
Q99X30 3.51e-73 230 44 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJI1 3.51e-73 230 44 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain COL)
Q2G1G6 3.51e-73 230 44 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK71 3.51e-73 230 44 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain USA300)
Q2YUY9 4.85e-73 229 44 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A2C9U9 2.35e-72 228 44 2 281 3 murQ N-acetylmuramic acid 6-phosphate etherase Prochlorococcus marinus (strain MIT 9303)
A8GI17 2.94e-72 228 46 0 276 3 murQ N-acetylmuramic acid 6-phosphate etherase Serratia proteamaculans (strain 568)
Q040J1 2.94e-72 228 44 0 274 3 murQ N-acetylmuramic acid 6-phosphate etherase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q71Z09 5.29e-72 227 44 0 261 3 murQ N-acetylmuramic acid 6-phosphate etherase Listeria monocytogenes serotype 4b (strain F2365)
C1KVV7 5.29e-72 227 44 0 261 3 murQ N-acetylmuramic acid 6-phosphate etherase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q5WLA2 5.97e-72 227 44 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Shouchella clausii (strain KSM-K16)
Q2S6G3 1.04e-71 226 43 1 280 3 murQ N-acetylmuramic acid 6-phosphate etherase Salinibacter ruber (strain DSM 13855 / M31)
Q04HN0 1.05e-71 226 43 0 264 3 murQ N-acetylmuramic acid 6-phosphate etherase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A0M6M4 1.12e-71 225 47 0 240 3 murQ N-acetylmuramic acid 6-phosphate etherase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A8F7W0 1.17e-71 226 44 0 274 3 murQ N-acetylmuramic acid 6-phosphate etherase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q74HC8 3.02e-71 225 43 0 270 3 murQ N-acetylmuramic acid 6-phosphate etherase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q6A8M7 6.64e-71 224 44 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q65CQ5 2.31e-70 223 43 0 260 3 murQ2 N-acetylmuramic acid 6-phosphate etherase 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q480D3 4.66e-70 222 47 2 261 3 murQ N-acetylmuramic acid 6-phosphate etherase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q49ZN6 8.35e-70 221 44 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q46L21 1.09e-69 221 41 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Prochlorococcus marinus (strain NATL2A)
Q5LI89 1.31e-69 220 45 1 274 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q15N71 2.08e-69 221 43 2 286 3 murQ N-acetylmuramic acid 6-phosphate etherase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q64ZA1 2.46e-69 219 45 1 274 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacteroides fragilis (strain YCH46)
Q7V7N4 3.8e-69 220 42 2 281 3 murQ N-acetylmuramic acid 6-phosphate etherase Prochlorococcus marinus (strain MIT 9313)
Q8ESL3 6.69e-69 219 41 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8YUC0 7.3e-69 219 42 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8CRD9 8.38e-69 219 42 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLT3 8.38e-69 219 42 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B1WPP6 4.14e-68 217 43 0 272 3 murQ N-acetylmuramic acid 6-phosphate etherase Crocosphaera subtropica (strain ATCC 51142 / BH68)
A2RL43 5.42e-68 216 44 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Lactococcus lactis subsp. cremoris (strain MG1363)
Q8ABH7 8.09e-68 215 47 1 250 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q02Z51 9.01e-68 216 44 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Lactococcus lactis subsp. cremoris (strain SK11)
Q3MGL8 9.07e-68 216 42 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q831R4 9.44e-68 216 47 0 242 3 murQ2 N-acetylmuramic acid 6-phosphate etherase 2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q9CGG6 1.02e-67 216 44 0 268 3 murQ N-acetylmuramic acid 6-phosphate etherase Lactococcus lactis subsp. lactis (strain IL1403)
Q1AYD7 2.81e-67 215 40 0 283 3 murQ N-acetylmuramic acid 6-phosphate etherase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q119L1 2.98e-67 215 42 0 281 3 murQ N-acetylmuramic acid 6-phosphate etherase Trichodesmium erythraeum (strain IMS101)
Q03QK0 8.26e-67 214 42 0 266 3 murQ N-acetylmuramic acid 6-phosphate etherase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B0TXA4 1.68e-66 213 43 1 274 3 murQ N-acetylmuramic acid 6-phosphate etherase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A9BFQ1 2.09e-66 213 42 0 261 3 murQ N-acetylmuramic acid 6-phosphate etherase Petrotoga mobilis (strain DSM 10674 / SJ95)
B7KFK5 2.65e-66 213 43 0 272 3 murQ N-acetylmuramic acid 6-phosphate etherase Gloeothece citriformis (strain PCC 7424)
Q3AXW8 4.41e-66 212 43 0 281 3 murQ N-acetylmuramic acid 6-phosphate etherase Synechococcus sp. (strain CC9902)
Q9KXT4 9.15e-66 211 44 0 257 3 murQ N-acetylmuramic acid 6-phosphate etherase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q7MVG5 2.06e-65 209 47 0 241 3 murQ N-acetylmuramic acid 6-phosphate etherase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RK20 3.39e-65 209 47 0 241 3 murQ N-acetylmuramic acid 6-phosphate etherase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
B2IU18 3.56e-65 210 41 0 276 3 murQ N-acetylmuramic acid 6-phosphate etherase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q8DJQ1 4.37e-65 209 42 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q39MM8 9.21e-65 208 42 1 261 3 murQ N-acetylmuramic acid 6-phosphate etherase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5NEW3 9.71e-65 208 42 1 274 3 murQ N-acetylmuramic acid 6-phosphate etherase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q2A5B0 1.23e-64 208 42 1 274 3 murQ N-acetylmuramic acid 6-phosphate etherase Francisella tularensis subsp. holarctica (strain LVS)
A2C236 6.53e-64 206 42 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Prochlorococcus marinus (strain NATL1A)
A0Q804 1.17e-63 205 41 1 274 3 murQ N-acetylmuramic acid 6-phosphate etherase Francisella tularensis subsp. novicida (strain U112)
Q82GH3 7.29e-63 204 44 0 256 3 murQ N-acetylmuramic acid 6-phosphate etherase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q3AJT5 8.79e-63 204 43 0 281 3 murQ N-acetylmuramic acid 6-phosphate etherase Synechococcus sp. (strain CC9605)
Q47U25 9.37e-63 203 44 1 258 3 murQ N-acetylmuramic acid 6-phosphate etherase Thermobifida fusca (strain YX)
B1XMC7 1.13e-62 203 40 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q7VC01 1.33e-62 203 43 0 251 3 murQ N-acetylmuramic acid 6-phosphate etherase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
B7JYZ1 1.51e-62 203 39 0 281 3 murQ N-acetylmuramic acid 6-phosphate etherase Rippkaea orientalis (strain PCC 8801 / RF-1)
B0JQG3 4.47e-61 199 39 0 281 3 murQ N-acetylmuramic acid 6-phosphate etherase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q7NE68 2.25e-60 197 44 0 260 3 murQ N-acetylmuramic acid 6-phosphate etherase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7U6S0 8.14e-60 196 41 0 281 3 murQ N-acetylmuramic acid 6-phosphate etherase Parasynechococcus marenigrum (strain WH8102)
Q5N1U7 1.79e-59 195 38 0 284 3 murQ N-acetylmuramic acid 6-phosphate etherase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
O33701 1.79e-59 195 38 0 284 3 murQ N-acetylmuramic acid 6-phosphate etherase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P73585 2.58e-59 194 39 0 281 3 murQ N-acetylmuramic acid 6-phosphate etherase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9RYU5 4.62e-52 176 37 2 286 3 murQ N-acetylmuramic acid 6-phosphate etherase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q1J3J3 1.26e-48 167 40 0 276 3 murQ N-acetylmuramic acid 6-phosphate etherase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
A8FMK7 1.9e-12 68 32 2 134 3 gmhA Phosphoheptose isomerase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q9PNE6 2.57e-11 64 32 2 134 1 gmhA1 Phosphoheptose isomerase 1 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B8J0B1 4.08e-07 53 32 2 128 3 gmhA Phosphoheptose isomerase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q91754 4.72e-07 54 24 8 252 1 gckr Glucokinase regulatory protein Xenopus laevis
B9KFJ1 1.51e-06 51 27 4 144 3 gmhA Phosphoheptose isomerase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q91X44 3.5e-06 52 28 5 192 1 Gckr Glucokinase regulatory protein Mus musculus
Q07071 5.99e-06 51 27 8 239 1 Gckr Glucokinase regulatory protein Rattus norvegicus
Q7VFZ4 9.41e-06 48 27 3 143 3 gmhA Phosphoheptose isomerase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B6JM81 2.02e-05 48 28 3 149 3 gmhA Phosphoheptose isomerase Helicobacter pylori (strain P12)
Q14397 2.31e-05 49 26 8 239 1 GCKR Glucokinase regulatory protein Homo sapiens
O25528 2.64e-05 47 28 2 138 3 gmhA Phosphoheptose isomerase Helicobacter pylori (strain ATCC 700392 / 26695)
B2USX3 2.92e-05 47 27 2 138 3 gmhA Phosphoheptose isomerase Helicobacter pylori (strain Shi470)
A5G5G9 3.32e-05 47 28 3 149 3 gmhA Phosphoheptose isomerase Geotalea uraniireducens (strain Rf4)
Q1CT15 4.59e-05 47 27 2 138 3 gmhA Phosphoheptose isomerase Helicobacter pylori (strain HPAG1)
A1AV13 4.98e-05 47 26 2 139 3 gmhA Phosphoheptose isomerase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q9ZJ94 6.33e-05 48 34 1 92 3 glmS Glutamine--fructose-6-phosphate aminotransferase [isomerizing] Helicobacter pylori (strain J99 / ATCC 700824)
O26060 6.56e-05 48 34 1 92 3 glmS Glutamine--fructose-6-phosphate aminotransferase [isomerizing] Helicobacter pylori (strain ATCC 700392 / 26695)
Q9KG85 7.19e-05 47 24 2 141 3 BH0227 UPF0309 protein BH0227 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9ZKZ1 0.000167 45 26 2 138 3 gmhA Phosphoheptose isomerase Helicobacter pylori (strain J99 / ATCC 700824)
Q3JP41 0.000241 45 27 2 143 3 gmhA Phosphoheptose isomerase Burkholderia pseudomallei (strain 1710b)
Q9AI36 0.000241 45 27 2 143 3 gmhA Phosphoheptose isomerase Burkholderia mallei (strain ATCC 23344)
Q93UJ2 0.00028 44 27 2 143 1 gmhA Phosphoheptose isomerase Burkholderia pseudomallei (strain K96243)
C6E6C5 0.000402 44 26 3 153 3 gmhA Phosphoheptose isomerase Geobacter sp. (strain M21)
B2UNE0 0.00071 43 27 3 132 3 gmhA Phosphoheptose isomerase Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q2RR43 0.000802 43 25 2 139 3 gmhA Phosphoheptose isomerase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17470
Feature type CDS
Gene murQ
Product N-acetylmuramic acid 6-phosphate etherase
Location 3834299 - 3835213 (strand: 1)
Length 915 (nucleotides) / 304 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_342
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF20741 C-terminal lid domain of glucokinase regulatory protein
PF22645 Glucokinase regulatory protein N-terminal SIS domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2103 Cell wall/membrane/envelope biogenesis (M) M N-acetylmuramic acid 6-phosphate (MurNAc-6-P) etherase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07106 N-acetylmuramic acid 6-phosphate etherase [EC:4.2.1.126] Amino sugar and nucleotide sugar metabolism
Metabolic pathways		 -

Protein Sequence

MKDDALSLCLQNESNQETTQFSELSTLALVSLINSADITVAYAVKKELPAIAKAVDKICERLRQGGRIFYVGAGTSGRLAVLDSAECPPTFGVSPSLVQAIIAGGHDAMLQAVENIEDNQQAAIEELQRREVNSNDVVIGIAASGRTPFTVAALQYAKQINALTLSITTRGKGMMSEIADLSIAPDVGAEVLTGSTRMKSGTAQKMILGMLSTSVMTRLGKVHKNLMVDVVASNEKLQRRAEGIVSEVCGITTQKAAELLKMVNYHPRKAILMYELHLSVEKVEQMTQRYPYHSLQQQLALFNE

Flanking regions ( +/- flanking 50bp)

TTCATTATATGTAATTTTAATTGAAATACTATTTCATTAAGGTTATTACAATGAAAGATGATGCATTGAGTTTATGTCTTCAAAATGAAAGTAACCAAGAGACCACACAATTTTCTGAGCTAAGTACCTTAGCGTTAGTTTCGTTAATTAATAGTGCCGATATCACCGTGGCCTATGCCGTAAAGAAAGAATTACCCGCAATCGCGAAAGCCGTAGACAAAATTTGTGAACGTCTACGTCAAGGGGGACGCATTTTTTATGTCGGCGCAGGAACAAGTGGCCGATTAGCGGTATTAGATAGCGCGGAATGTCCGCCTACTTTTGGCGTTTCTCCCTCACTGGTACAAGCCATTATTGCTGGTGGGCATGATGCTATGCTTCAAGCCGTTGAGAATATTGAAGATAATCAACAAGCTGCTATCGAAGAGTTGCAACGCCGTGAGGTAAATTCTAACGATGTCGTTATTGGTATCGCTGCCAGTGGTCGCACGCCATTTACAGTGGCTGCATTACAGTATGCAAAGCAGATCAATGCATTAACGCTCTCAATTACTACCCGCGGTAAAGGTATGATGAGTGAAATAGCCGATTTATCCATCGCGCCAGATGTCGGCGCCGAAGTGTTAACAGGCTCGACAAGAATGAAAAGTGGCACGGCTCAAAAAATGATCTTAGGTATGCTAAGTACCAGTGTAATGACTCGTTTAGGTAAGGTGCATAAAAACCTGATGGTCGATGTCGTGGCCAGTAATGAAAAATTACAGCGACGTGCTGAAGGTATTGTGAGTGAAGTGTGTGGGATCACAACACAAAAAGCAGCGGAGTTATTAAAAATGGTTAATTATCATCCGCGAAAAGCCATTTTAATGTATGAGCTTCATCTGAGTGTAGAGAAGGTTGAGCAAATGACACAACGCTATCCTTACCACTCTTTACAACAACAGTTAGCTCTATTTAATGAATAACAATATCAGTCAATCCTCTGAACTCTAGCAGGCACAATTATGGCTAATAA