Homologs in group_308

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11810 FBDBKF_11810 71.6 Morganella morganii S1 murQ N-acetylmuramic acid 6-phosphate etherase
EHELCC_14495 EHELCC_14495 71.6 Morganella morganii S2 murQ N-acetylmuramic acid 6-phosphate etherase
NLDBIP_15590 NLDBIP_15590 71.6 Morganella morganii S4 murQ N-acetylmuramic acid 6-phosphate etherase
LHKJJB_15020 LHKJJB_15020 71.6 Morganella morganii S3 murQ N-acetylmuramic acid 6-phosphate etherase
HKOGLL_14140 HKOGLL_14140 71.6 Morganella morganii S5 murQ N-acetylmuramic acid 6-phosphate etherase
F4V73_RS14845 F4V73_RS14845 74.2 Morganella psychrotolerans murQ N-acetylmuramic acid 6-phosphate etherase
PMI_RS17470 PMI_RS17470 43.7 Proteus mirabilis HI4320 murQ N-acetylmuramic acid 6-phosphate etherase

Distribution of the homologs in the orthogroup group_308

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_308

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N9D8 1.55e-159 449 73 0 298 3 murQ N-acetylmuramic acid 6-phosphate etherase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6LL16 9.24e-158 444 71 0 298 3 murQ N-acetylmuramic acid 6-phosphate etherase Photobacterium profundum (strain SS9)
Q5E5T7 3.46e-156 441 71 0 298 3 murQ N-acetylmuramic acid 6-phosphate etherase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FDJ8 3.61e-156 441 71 0 298 3 murQ N-acetylmuramic acid 6-phosphate etherase Aliivibrio fischeri (strain MJ11)
B6EJZ8 5.99e-153 432 69 0 298 3 murQ N-acetylmuramic acid 6-phosphate etherase Aliivibrio salmonicida (strain LFI1238)
Q87FD6 9.57e-149 422 70 0 297 3 murQ2 N-acetylmuramic acid 6-phosphate etherase 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8GC81 6.09e-148 420 67 0 299 3 murQ N-acetylmuramic acid 6-phosphate etherase Klebsiella aerogenes
Q7MBS3 2.97e-146 416 70 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Vibrio vulnificus (strain YJ016)
Q8D4Z4 2.97e-146 416 70 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Vibrio vulnificus (strain CMCP6)
A0KFC0 3.67e-146 415 67 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C5BBH3 3.91e-144 410 66 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Edwardsiella ictaluri (strain 93-146)
A1STT9 5.48e-144 410 67 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q9KVE0 4.25e-143 407 70 0 297 3 murQ1 N-acetylmuramic acid 6-phosphate etherase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P57951 6.38e-138 394 68 0 290 3 murQ N-acetylmuramic acid 6-phosphate etherase Pasteurella multocida (strain Pm70)
Q9KU39 6.61e-136 389 64 0 293 3 murQ2 N-acetylmuramic acid 6-phosphate etherase 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B1JRW1 2.89e-133 382 63 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667V7 2.89e-133 382 63 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TMY1 2.89e-133 382 63 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pestis (strain Pestoides F)
Q1CKD6 2.89e-133 382 63 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R410 2.89e-133 382 63 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZCP8 2.89e-133 382 63 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pestis
B2KA40 2.89e-133 382 63 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C5E3 2.89e-133 382 63 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFU6 2.89e-133 382 63 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B0BRD0 1.98e-129 373 61 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A6VKY9 5.12e-129 372 62 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A3N2I4 7.11e-129 372 61 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q65R16 1.14e-128 371 59 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B7VJM5 2.54e-128 370 61 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Vibrio atlanticus (strain LGP32)
Q87S81 7.52e-128 369 61 0 293 3 murQ1 N-acetylmuramic acid 6-phosphate etherase 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3KUL4 4.28e-127 367 58 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain 657 / Type Ba4)
B3GYL8 4.58e-127 367 60 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A8GI17 5.39e-127 367 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Serratia proteamaculans (strain 568)
B8F4V1 1.28e-126 366 60 0 289 3 murQ N-acetylmuramic acid 6-phosphate etherase Glaesserella parasuis serovar 5 (strain SH0165)
B0K1N2 3.06e-126 365 60 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Thermoanaerobacter sp. (strain X514)
C1FLJ7 3.93e-126 364 58 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain Kyoto / Type A2)
A5I1H8 3.93e-126 364 58 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FTM1 3.93e-126 364 58 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain ATCC 19397 / Type A)
Q1R8U4 1.13e-125 363 62 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain UTI89 / UPEC)
A1ADU3 1.13e-125 363 62 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O1:K1 / APEC
B7MHT0 1.13e-125 363 62 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O45:K1 (strain S88 / ExPEC)
A7GD48 1.19e-125 363 58 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q6D234 1.53e-125 363 59 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1L0G9 4.04e-125 362 57 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain Loch Maree / Type A3)
Q8FFB0 1.28e-124 360 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TF40 1.28e-124 360 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1IK79 1.58e-124 360 57 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain Okra / Type B1)
Q31Y51 1.59e-124 360 62 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Shigella boydii serotype 4 (strain Sb227)
B2TX17 1.59e-124 360 62 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I504 1.77e-124 360 62 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain SE11)
B7M6T7 1.77e-124 360 62 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O8 (strain IAI1)
B7LCH2 1.77e-124 360 62 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain 55989 / EAEC)
A7ZPM8 1.77e-124 360 62 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7UGC8 4.03e-124 359 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P76535 5.23e-124 359 63 0 292 1 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain K12)
B1IX44 5.23e-124 359 63 0 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A2S5 5.23e-124 359 63 0 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O9:H4 (strain HS)
B1XA99 5.23e-124 359 63 0 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain K12 / DH10B)
C4ZVV9 5.23e-124 359 63 0 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain K12 / MC4100 / BW2952)
Q0T280 7.03e-124 358 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Shigella flexneri serotype 5b (strain 8401)
B7MY79 9.55e-124 358 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O81 (strain ED1a)
Q3YZB4 1.33e-123 358 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Shigella sonnei (strain Ss046)
B7NPW4 1.88e-123 357 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LKK7 2.24e-123 357 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7N618 2.39e-123 357 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5YZX3 3.43e-123 357 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XBJ2 3.43e-123 357 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli O157:H7
Q83QN4 5.14e-123 357 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Shigella flexneri
Q32DC6 5.2e-123 356 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Shigella dysenteriae serotype 1 (strain Sd197)
A7MGZ1 7.05e-123 356 60 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Cronobacter sakazakii (strain ATCC BAA-894)
B1LMM2 3.37e-122 354 61 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Escherichia coli (strain SMS-3-5 / SECEC)
B2VEB1 5.06e-122 354 59 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MTC9 1.33e-121 353 58 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Vibrio campbellii (strain ATCC BAA-1116)
A4WDD1 2.57e-121 352 59 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Enterobacter sp. (strain 638)
P44862 1.07e-118 346 57 0 295 1 murQ N-acetylmuramic acid 6-phosphate etherase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B0UW11 8.7e-118 343 56 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Histophilus somni (strain 2336)
Q0I1F8 1.93e-117 342 55 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Histophilus somni (strain 129Pt)
A6X3M9 1.94e-117 343 57 0 294 3 murQ N-acetylmuramic acid 6-phosphate etherase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B9JJJ9 2.05e-117 343 56 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q986Q8 1.67e-116 340 55 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A6LUQ7 2.14e-116 340 55 0 296 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
C5DAG6 2.07e-115 337 54 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Geobacillus sp. (strain WCH70)
B5F1F1 5.94e-114 333 58 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella agona (strain SL483)
Q8Z4L2 3.48e-113 332 58 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella typhi
B5RD39 3.84e-113 331 58 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QTT8 3.84e-113 331 58 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella enteritidis PT4 (strain P125109)
B5FRB5 3.84e-113 331 58 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella dublin (strain CT_02021853)
Q57LE0 5.05e-113 331 57 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella choleraesuis (strain SC-B67)
Q71Z09 6.41e-113 331 54 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Listeria monocytogenes serotype 4b (strain F2365)
C1KVV7 6.41e-113 331 54 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Listeria monocytogenes serotype 4b (strain CLIP80459)
B4TS04 1.87e-112 330 57 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella schwarzengrund (strain CVM19633)
Q8ZN25 2.54e-112 329 57 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BAU0 2.54e-112 329 57 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella paratyphi A (strain AKU_12601)
Q5PII8 2.54e-112 329 57 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T1E8 2.54e-112 329 57 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella newport (strain SL254)
B4TDE5 2.54e-112 329 57 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella heidelberg (strain SL476)
Q8RD35 6.15e-112 328 54 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A6TVQ2 9.63e-112 328 55 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Alkaliphilus metalliredigens (strain QYMF)
A9N1U1 1.43e-111 327 57 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q15N71 6.43e-111 326 56 0 296 3 murQ N-acetylmuramic acid 6-phosphate etherase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q480D3 9.96e-111 326 54 0 294 3 murQ N-acetylmuramic acid 6-phosphate etherase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q28KP2 2.32e-110 325 52 0 296 3 murQ N-acetylmuramic acid 6-phosphate etherase Jannaschia sp. (strain CCS1)
C4KZ07 7.82e-110 323 54 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q9CGG6 8.85e-109 320 52 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Lactococcus lactis subsp. lactis (strain IL1403)
Q88SB0 6.24e-108 318 52 0 295 3 murQ2 N-acetylmuramic acid 6-phosphate etherase 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q02Z51 1.7e-107 317 51 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Lactococcus lactis subsp. cremoris (strain SK11)
A2RL43 2.31e-107 317 51 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Lactococcus lactis subsp. cremoris (strain MG1363)
A0AJB3 6.04e-107 315 52 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q184N3 3.41e-106 314 51 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridioides difficile (strain 630)
Q5FIF8 3.91e-106 313 51 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B2TPW8 1.01e-105 313 51 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium botulinum (strain Eklund 17B / Type B)
A7GLK9 1.72e-105 312 52 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q9K6Z9 1.13e-104 310 53 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B7II82 1.86e-104 309 51 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain G9842)
Q81UP1 2.49e-104 309 51 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus anthracis
C3LE93 2.49e-104 309 51 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P1J8 2.49e-104 309 51 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus anthracis (strain A0248)
Q81HH1 4.85e-104 308 50 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
C1EYT0 5.65e-104 308 50 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain 03BB102)
B7HER4 6.03e-104 308 50 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain B4264)
Q65P54 7.22e-104 308 52 0 294 3 murQ1 N-acetylmuramic acid 6-phosphate etherase 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B9IR64 7.66e-104 308 51 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain Q1)
B7HXH0 7.66e-104 308 51 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain AH187)
Q04HN0 9.66e-104 307 51 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
B7JSA1 1.07e-103 307 50 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain AH820)
A4IPI2 1.28e-103 307 51 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Geobacillus thermodenitrificans (strain NG80-2)
Q73D01 1.29e-103 307 51 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6HMZ5 2e-103 306 51 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus thuringiensis subsp. konkukian (strain 97-27)
A0QNX1 6.17e-103 305 50 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q63FJ0 6.65e-103 305 50 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus cereus (strain ZK / E33L)
Q2S6G3 8.71e-103 305 52 1 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Salinibacter ruber (strain DSM 13855 / M31)
Q67RV4 9.05e-103 305 55 1 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A9VGE7 2.31e-102 304 51 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus mycoides (strain KBAB4)
Q838I8 2.97e-102 304 51 0 296 3 murQ1 N-acetylmuramic acid 6-phosphate etherase 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q97MM1 5.25e-102 303 51 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q45582 1.94e-101 302 51 0 295 1 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus subtilis (strain 168)
Q7UNL6 1.12e-100 300 51 0 294 3 murQ N-acetylmuramic acid 6-phosphate etherase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8ESL3 2.59e-100 299 52 0 291 3 murQ N-acetylmuramic acid 6-phosphate etherase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q040J1 1.5e-99 297 50 0 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q5WLA2 4.52e-99 296 50 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Shouchella clausii (strain KSM-K16)
Q2JMP1 1.87e-98 294 55 1 297 3 murQ N-acetylmuramic acid 6-phosphate etherase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q74HC8 6.82e-98 293 50 0 291 3 murQ N-acetylmuramic acid 6-phosphate etherase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q88SC3 8.39e-98 293 51 0 298 3 murQ1 N-acetylmuramic acid 6-phosphate etherase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B0TXA4 1.01e-97 292 50 0 290 3 murQ N-acetylmuramic acid 6-phosphate etherase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q831R4 1.94e-97 291 50 0 295 3 murQ2 N-acetylmuramic acid 6-phosphate etherase 2 Enterococcus faecalis (strain ATCC 700802 / V583)
A0Q804 6.16e-97 290 49 0 290 3 murQ N-acetylmuramic acid 6-phosphate etherase Francisella tularensis subsp. novicida (strain U112)
Q5NEW3 3.41e-96 288 49 0 290 3 murQ N-acetylmuramic acid 6-phosphate etherase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q03QK0 4.48e-96 288 48 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q6A8M7 4.53e-96 288 52 0 288 3 murQ N-acetylmuramic acid 6-phosphate etherase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q4L8H4 8.9e-96 287 49 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus haemolyticus (strain JCSC1435)
Q2A5B0 6.47e-95 285 48 0 290 3 murQ N-acetylmuramic acid 6-phosphate etherase Francisella tularensis subsp. holarctica (strain LVS)
Q8CRD9 1.6e-94 284 47 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLT3 1.6e-94 284 47 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A8F9E0 1.1e-93 282 48 0 294 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus pumilus (strain SAFR-032)
Q2YUY9 5.33e-93 280 47 5 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A1Y2 1.06e-92 280 47 5 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain MW2)
Q6GCT5 1.06e-92 280 47 5 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain MSSA476)
Q6GKB5 1.06e-92 280 47 5 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain MRSA252)
Q7A805 1.06e-92 280 47 5 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain N315)
Q99X30 1.06e-92 280 47 5 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJI1 1.06e-92 280 47 5 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain COL)
Q2G1G6 1.06e-92 280 47 5 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK71 1.06e-92 280 47 5 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus aureus (strain USA300)
Q49ZN6 1.11e-92 279 47 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9KXT4 1.43e-92 280 51 0 291 3 murQ N-acetylmuramic acid 6-phosphate etherase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A7Z0U6 7.58e-92 278 49 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q82GH3 1.18e-89 272 52 0 291 3 murQ N-acetylmuramic acid 6-phosphate etherase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q1AYD7 2.8e-89 271 47 1 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q5LI89 2.98e-87 265 54 1 240 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q6MTZ7 5.37e-87 265 48 0 277 3 murQ N-acetylmuramic acid 6-phosphate etherase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q64ZA1 6.1e-87 264 54 1 240 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacteroides fragilis (strain YCH46)
A0M6M4 8.66e-87 263 51 0 246 3 murQ N-acetylmuramic acid 6-phosphate etherase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q8ABH7 3.14e-85 259 52 1 253 3 murQ N-acetylmuramic acid 6-phosphate etherase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q46L21 3.66e-85 261 44 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Prochlorococcus marinus (strain NATL2A)
B7KFK5 1.03e-84 259 45 0 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Gloeothece citriformis (strain PCC 7424)
B2RK20 1.17e-84 258 53 2 253 3 murQ N-acetylmuramic acid 6-phosphate etherase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q7MVG5 2.38e-84 257 56 0 228 3 murQ N-acetylmuramic acid 6-phosphate etherase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
A2C9U9 9.48e-84 257 45 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Prochlorococcus marinus (strain MIT 9303)
Q7V7N4 1.13e-83 257 45 0 294 3 murQ N-acetylmuramic acid 6-phosphate etherase Prochlorococcus marinus (strain MIT 9313)
B1WPP6 2.29e-83 256 45 0 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q119L1 6.08e-83 255 43 0 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Trichodesmium erythraeum (strain IMS101)
Q3MGL8 7.39e-82 252 44 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8YUC0 1.34e-81 251 44 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P73585 4.6e-81 250 44 0 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5N1U7 1.86e-80 248 44 0 294 3 murQ N-acetylmuramic acid 6-phosphate etherase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
O33701 1.86e-80 248 44 0 294 3 murQ N-acetylmuramic acid 6-phosphate etherase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7U6S0 5.15e-80 248 45 0 296 3 murQ N-acetylmuramic acid 6-phosphate etherase Parasynechococcus marenigrum (strain WH8102)
Q39MM8 9.06e-80 246 47 1 294 3 murQ N-acetylmuramic acid 6-phosphate etherase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B1XMC7 6.83e-79 244 43 0 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A8F7W0 1.09e-78 244 45 3 296 3 murQ N-acetylmuramic acid 6-phosphate etherase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
A9BFQ1 2.01e-78 243 43 2 287 3 murQ N-acetylmuramic acid 6-phosphate etherase Petrotoga mobilis (strain DSM 10674 / SJ95)
A2C236 3.43e-78 243 43 0 291 3 murQ N-acetylmuramic acid 6-phosphate etherase Prochlorococcus marinus (strain NATL1A)
Q65CQ5 4.89e-78 242 41 0 288 3 murQ2 N-acetylmuramic acid 6-phosphate etherase 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8DJQ1 5.99e-78 242 43 0 291 3 murQ N-acetylmuramic acid 6-phosphate etherase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B0JQG3 7.71e-78 242 43 0 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
B7JYZ1 9.48e-78 241 43 0 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q7NE68 1.23e-77 241 47 0 293 3 murQ N-acetylmuramic acid 6-phosphate etherase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B2IU18 1.38e-77 241 44 0 292 3 murQ N-acetylmuramic acid 6-phosphate etherase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q7VC01 7.79e-77 239 40 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q3AXW8 7.57e-75 234 43 0 294 3 murQ N-acetylmuramic acid 6-phosphate etherase Synechococcus sp. (strain CC9902)
Q3AJT5 1.27e-74 234 46 0 295 3 murQ N-acetylmuramic acid 6-phosphate etherase Synechococcus sp. (strain CC9605)
Q47U25 6.46e-71 224 43 1 288 3 murQ N-acetylmuramic acid 6-phosphate etherase Thermobifida fusca (strain YX)
Q9RYU5 1.5e-70 223 42 0 290 3 murQ N-acetylmuramic acid 6-phosphate etherase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q1J3J3 1.61e-61 200 44 1 286 3 murQ N-acetylmuramic acid 6-phosphate etherase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q91754 6.53e-12 69 26 8 246 1 gckr Glucokinase regulatory protein Xenopus laevis
Q91754 1.19e-10 65 25 9 250 1 gckr Glucokinase regulatory protein Xenopus laevis
Q91X44 2.36e-07 55 29 4 141 1 Gckr Glucokinase regulatory protein Mus musculus
Q07071 6.36e-07 54 29 4 141 1 Gckr Glucokinase regulatory protein Rattus norvegicus
Q14397 4.54e-06 51 29 4 141 1 GCKR Glucokinase regulatory protein Homo sapiens
Q9PNE6 3.53e-05 47 28 1 125 1 gmhA1 Phosphoheptose isomerase 1 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9YAK0 9.26e-05 46 41 0 48 3 APE_1940.1 Uncharacterized protein APE_1940.1 Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
B8J0B1 0.000153 45 28 2 127 3 gmhA Phosphoheptose isomerase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q8RG65 0.00072 44 32 1 88 3 glmS Glutamine--fructose-6-phosphate aminotransferase [isomerizing] Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15530
Feature type CDS
Gene murQ
Product N-acetylmuramic acid 6-phosphate etherase
Location 3454388 - 3455287 (strand: 1)
Length 900 (nucleotides) / 299 (amino acids)
In genomic island GI63

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_308
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF22645 Glucokinase regulatory protein N-terminal SIS domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2103 Cell wall/membrane/envelope biogenesis (M) M N-acetylmuramic acid 6-phosphate (MurNAc-6-P) etherase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07106 N-acetylmuramic acid 6-phosphate etherase [EC:4.2.1.126] Amino sugar and nucleotide sugar metabolism
Metabolic pathways
-

Protein Sequence

MAIDLGHLVTESRNHHSEHIDTLSTLEMLKVINNEDKKVPFAVEATLPHIARLVDKVVTAFSQGGRLIYCGAGTSGRLGILDASECPPTYGTPHDMVIGLIAGGHKAILQAVENAEDNVQLGAEDLHQLNFNAKDVLVGIAASGRTPYVIGALEYARSLGAVTGAISCNPDSPIAQRADIAITPIVGPEVVTGSSRMKAGTAQKLVLNMITTGAMIKMGKVFGNLMVDVEATNAKLIERQIRIVMQATECDRATAEQALAQCQRHCKTAILMILAGVNAQQATQLLAQNKGFIRQALAK

Flanking regions ( +/- flanking 50bp)

CGTTGATGTTTTTTGAGATTAACAGATAAATAGCAATTTAGGGACTTAAAATGGCAATCGACCTTGGTCATCTGGTGACAGAAAGTCGCAATCATCACAGTGAACATATTGATACACTTTCAACACTTGAAATGCTAAAAGTCATTAATAATGAAGATAAAAAAGTGCCTTTTGCGGTTGAAGCCACATTACCCCATATTGCACGGCTGGTGGATAAGGTCGTAACAGCATTTTCTCAAGGTGGTCGATTAATTTATTGCGGTGCAGGTACTTCTGGTCGTTTGGGAATTTTAGATGCCAGTGAATGTCCTCCAACCTATGGAACCCCCCATGATATGGTGATTGGCTTAATTGCCGGGGGACACAAAGCCATTTTACAAGCGGTTGAAAATGCAGAAGATAATGTCCAATTGGGGGCAGAGGATTTACACCAGCTTAATTTTAATGCTAAGGATGTGCTAGTTGGGATTGCAGCCAGTGGTCGAACGCCTTATGTGATTGGCGCATTAGAATATGCACGCTCACTAGGTGCGGTGACCGGGGCAATTAGTTGTAATCCTGATAGTCCCATAGCGCAACGTGCCGATATTGCTATTACGCCGATTGTGGGGCCTGAAGTGGTAACTGGCTCATCACGTATGAAAGCAGGCACGGCACAAAAACTGGTATTAAATATGATAACCACAGGTGCCATGATAAAGATGGGTAAAGTATTTGGTAATTTAATGGTAGATGTTGAAGCCACTAATGCCAAATTAATTGAACGCCAAATTCGTATTGTGATGCAAGCAACAGAGTGTGATCGAGCTACTGCTGAACAAGCACTAGCACAATGCCAACGTCATTGTAAAACAGCGATTTTGATGATTTTAGCCGGCGTAAATGCACAACAAGCAACACAGTTGTTGGCGCAAAATAAAGGGTTTATTAGACAAGCTCTAGCTAAATGATAGCGTTACAGATTTGCTTTTAAACGGAATGATAAATGCTATCTTCGCAT