Homologs in group_263

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04745 FBDBKF_04745 20.8 Morganella morganii S1 glpR DeoR family transcriptional regulator
EHELCC_06035 EHELCC_06035 20.8 Morganella morganii S2 glpR DeoR family transcriptional regulator
NLDBIP_06355 NLDBIP_06355 20.8 Morganella morganii S4 glpR DeoR family transcriptional regulator
LHKJJB_03235 LHKJJB_03235 20.8 Morganella morganii S3 glpR DeoR family transcriptional regulator
HKOGLL_06710 HKOGLL_06710 20.8 Morganella morganii S5 glpR DeoR family transcriptional regulator
F4V73_RS09215 F4V73_RS09215 20.8 Morganella psychrotolerans - DeoR family transcriptional regulator
PMI_RS10550 PMI_RS10550 22.4 Proteus mirabilis HI4320 agaR transcriptional repressor AgaR

Distribution of the homologs in the orthogroup group_263

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_263

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACK5 8.37e-53 174 38 4 258 1 deoR Deoxyribose operon repressor Escherichia coli (strain K12)
P0ACK6 8.37e-53 174 38 4 258 3 deoR Deoxyribose operon repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACK7 8.37e-53 174 38 4 258 3 deoR Deoxyribose operon repressor Escherichia coli O157:H7
O05261 9.44e-16 77 26 3 234 4 yulB Uncharacterized HTH-type transcriptional regulator YulB Bacillus subtilis (strain 168)
P44780 5.54e-15 75 23 2 243 3 fucR L-fucose operon activator Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P26422 7.11e-15 75 28 8 244 4 lacR Lactose phosphotransferase system repressor Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P18816 7.9e-15 75 25 5 243 4 lacR Lactose phosphotransferase system repressor Lactococcus lactis subsp. lactis
P0ACK2 2.95e-14 73 22 1 254 4 agaR Putative aga operon transcriptional repressor Escherichia coli (strain K12)
P0ACK3 2.95e-14 73 22 1 254 3 agaR Putative aga operon transcriptional repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACK4 2.95e-14 73 22 1 254 3 agaR Putative aga operon transcriptional repressor Escherichia coli O157:H7
P76034 2.16e-13 71 24 3 238 4 yciT Uncharacterized HTH-type transcriptional regulator YciT Escherichia coli (strain K12)
P67744 8.96e-13 69 28 6 212 1 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain N315)
P67743 8.96e-13 69 28 6 212 3 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0A0P9 2.07e-12 68 28 6 212 3 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain MW2)
Q6G7B8 2.07e-12 68 28 6 212 3 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain MSSA476)
Q5HE08 2.07e-12 68 28 6 212 3 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain COL)
P0A0Q0 2.07e-12 68 28 6 212 4 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GEN3 2.27e-12 68 28 6 212 3 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain MRSA252)
P15082 2.27e-12 68 23 6 260 1 srlR Glucitol operon repressor Escherichia coli (strain K12)
P46337 2.33e-12 68 22 1 248 4 iolR HTH-type transcriptional regulator IolR Bacillus subtilis (strain 168)
D4GYE7 7.49e-12 67 23 7 260 2 glpR HTH-type transcriptional regulator GlpR Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q92ET8 1.57e-10 63 23 1 234 4 golR HTH-type transcriptional regulator GolR Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P32104 3.21e-10 62 22 3 210 4 accR Transcriptional repressor AccR Agrobacterium fabrum (strain C58 / ATCC 33970)
O31713 3.37e-10 62 23 6 260 4 fruR Uncharacterized HTH-type transcriptional regulator FruR Bacillus subtilis (strain 168)
P0ACL1 2.3e-09 59 22 1 234 4 glpR Glycerol-3-phosphate regulon repressor Shigella flexneri
P0ACL0 2.3e-09 59 22 1 234 1 glpR Glycerol-3-phosphate regulon repressor Escherichia coli (strain K12)
Q8CRJ1 2.51e-09 59 24 5 236 3 lacR Lactose phosphotransferase system repressor Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM34 2.51e-09 59 24 5 236 3 lacR Lactose phosphotransferase system repressor Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P94591 5.02e-09 58 24 4 234 1 glcR HTH-type transcriptional repressor GlcR Bacillus subtilis (strain 168)
P52598 1.99e-08 57 24 6 241 4 ygbI Uncharacterized HTH-type transcriptional regulator YgbI Escherichia coli (strain K12)
P77721 5.89e-07 52 17 3 253 1 ydjF Uncharacterized HTH-type transcriptional regulator YdjF Escherichia coli (strain K12)
P39361 1.16e-06 52 20 2 234 4 sgcR Putative sgc region transcriptional regulator Escherichia coli (strain K12)
P32144 1.7e-06 51 22 5 262 1 csqR HTH-type transcriptional repressor CsqR Escherichia coli (strain K12)
Q8CSL5 2.23e-06 51 22 5 260 4 SE_1102 Uncharacterized HTH-type transcriptional regulator SE_1102 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P44978 3.79e-06 50 22 3 249 4 HI_1009 Uncharacterized HTH-type transcriptional regulator HI_1009 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17455
Feature type CDS
Gene -
Product DeoR family transcriptional regulator
Location 3831482 - 3832258 (strand: -1)
Length 777 (nucleotides) / 258 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_263
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00455 DeoR C terminal sensor domain
PF08220 DeoR-like helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1349 Transcription (K)
Carbohydrate transport and metabolism (G)		 KG DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11534 DeoR family transcriptional regulator, deoxyribose operon repressor - -

Protein Sequence

MIETKQHERLRRLSECIKRSGRIHLKDAARILEVSEMTIRRDLSSDVENPYPMSLLGGYIVALAQPHSNLITSTSDIITPDQTQELHIPNLAAGMVSEGDVLFFDNGQLIPTLIELIPESLHFTGICYSHRVFLALSRKKNATVLLCGGEYRPKSDSFYNPLQPCYLDNINPKKAFISAEGVHLDFGVSCYNIDDLHMKRKAMDKSIRKILLTKYHAFDETATGNMGDLAQFDVVITDRKLTDDYEAYCRKSSVKIIY

Flanking regions ( +/- flanking 50bp)

TAGCGTATCGTTATATGGGATACGCTATTCGATAATAGAAGGATCCTTAGGTGATAGAGACCAAACAGCATGAACGTTTGCGTCGCCTTAGCGAATGCATAAAACGCTCAGGCCGCATCCATCTCAAAGATGCCGCGAGGATCCTTGAAGTATCTGAAATGACCATTCGTCGTGATCTCAGTTCAGATGTTGAAAACCCCTATCCGATGTCACTGCTTGGTGGCTATATTGTCGCGTTGGCACAACCTCATAGCAACCTAATCACATCGACTAGTGATATTATCACCCCGGATCAAACCCAAGAATTACACATTCCTAATCTTGCTGCGGGCATGGTGTCTGAAGGTGATGTACTATTTTTTGATAATGGCCAACTTATTCCGACATTAATTGAGCTTATTCCTGAGAGTTTACACTTTACTGGTATTTGTTATTCGCACCGCGTTTTCCTGGCATTAAGCCGAAAGAAAAATGCGACCGTACTACTGTGTGGTGGCGAATATCGCCCTAAAAGCGACTCATTTTATAATCCCCTCCAGCCTTGTTACCTTGATAACATAAACCCGAAAAAAGCCTTTATTTCCGCAGAGGGTGTCCACCTCGATTTTGGTGTCTCTTGCTACAACATTGATGATCTTCATATGAAAAGAAAAGCGATGGATAAATCGATTCGCAAGATCTTACTCACCAAATACCATGCCTTCGATGAAACTGCCACAGGCAATATGGGCGATTTAGCGCAATTTGATGTCGTGATCACCGATAGAAAATTAACAGATGATTACGAAGCCTATTGCCGAAAAAGCTCAGTTAAAATTATTTATTAACCCAAAAGAAAAATCTCACTGTTCCCTAATTTACTTTTTTTGGTAAACAG