Homologs in group_99

Help

11 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16655 FBDBKF_16655 55.8 Morganella morganii S1 - Antirestriction protein
FBDBKF_18010 FBDBKF_18010 58.0 Morganella morganii S1 - Antirestriction protein
FBDBKF_19875 FBDBKF_19875 57.4 Morganella morganii S1 - Antirestriction protein
EHELCC_07740 EHELCC_07740 57.4 Morganella morganii S2 - Antirestriction protein
EHELCC_16710 EHELCC_16710 58.0 Morganella morganii S2 - Antirestriction protein
NLDBIP_08065 NLDBIP_08065 57.4 Morganella morganii S4 - Antirestriction protein
NLDBIP_17740 NLDBIP_17740 58.0 Morganella morganii S4 - Antirestriction protein
LHKJJB_06200 LHKJJB_06200 57.4 Morganella morganii S3 - Antirestriction protein
LHKJJB_17660 LHKJJB_17660 58.0 Morganella morganii S3 - Antirestriction protein
HKOGLL_17475 HKOGLL_17475 58.0 Morganella morganii S5 - Antirestriction protein
HKOGLL_19055 HKOGLL_19055 57.4 Morganella morganii S5 - Antirestriction protein

Distribution of the homologs in the orthogroup group_99

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_99

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P52139 8.92e-43 141 50 1 140 3 yfjX Uncharacterized protein YfjX Escherichia coli (strain K12)
P75676 6.23e-42 139 48 1 140 3 yafX Uncharacterized protein YafX Escherichia coli (strain K12)
P52602 3.21e-19 81 32 3 143 3 klcA Antirestriction protein KlcA Escherichia coli
P52603 3.42e-16 73 31 3 141 2 klcA Antirestriction protein KlcA Escherichia coli
Q9S4W7 1.34e-10 58 30 5 144 3 yubI Putative antirestriction protein YubI Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17350
Feature type CDS
Gene -
Product antirestriction protein
Location 3809732 - 3810157 (strand: 1)
Length 426 (nucleotides) / 141 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_99
Orthogroup size 12
N. genomes 6

Actions

Genomic region

Domains

PF03230 Antirestriction protein

Protein Sequence

MNNTTESAIAMTLVLDEQRLDFWFNHFGAVKDWATFEVVIFTTMGQFCDEYHGGYWEYGSLNNGGAFIYPDINADTLTLFNMHNGNEATVSQEAAGIAVCLILYSIWSFQTKSEVMCDRFYQLRDYALQHSESAAIFHLID

Flanking regions ( +/- flanking 50bp)

CCTTAACGGGATTGGCGCTTTTTTATTTCTTTTTATTGGAGTCTCAACTTATGAATAACACAACTGAATCCGCCATTGCAATGACACTCGTCCTTGATGAGCAACGCCTTGATTTTTGGTTCAACCATTTTGGTGCAGTAAAAGATTGGGCCACCTTTGAAGTGGTCATCTTCACCACGATGGGTCAATTCTGCGATGAGTATCATGGCGGTTACTGGGAGTACGGCTCACTCAATAATGGCGGTGCCTTTATCTACCCCGATATCAACGCAGACACCTTAACCCTATTCAACATGCACAACGGCAATGAAGCCACCGTGAGCCAAGAAGCGGCAGGGATTGCCGTATGCCTTATCCTGTACAGCATCTGGTCATTCCAAACAAAAAGCGAAGTGATGTGCGACCGCTTTTATCAACTGCGTGACTATGCCCTACAACATTCTGAATCCGCTGCCATTTTCCATTTAATTGATTAATCAGGAGTTTTATCATGAGTTTATTAGCGTCTCGTTTTGGCTCTGCTAAC