Homologs in group_97

Help

11 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16655 FBDBKF_16655 93.8 Morganella morganii S1 - Antirestriction protein
FBDBKF_18010 FBDBKF_18010 100.0 Morganella morganii S1 - Antirestriction protein
FBDBKF_19875 FBDBKF_19875 60.9 Morganella morganii S1 - Antirestriction protein
EHELCC_07740 EHELCC_07740 60.9 Morganella morganii S2 - Antirestriction protein
EHELCC_16710 EHELCC_16710 100.0 Morganella morganii S2 - Antirestriction protein
NLDBIP_08065 NLDBIP_08065 60.9 Morganella morganii S4 - Antirestriction protein
LHKJJB_06200 LHKJJB_06200 60.9 Morganella morganii S3 - Antirestriction protein
LHKJJB_17660 LHKJJB_17660 100.0 Morganella morganii S3 - Antirestriction protein
HKOGLL_17475 HKOGLL_17475 100.0 Morganella morganii S5 - Antirestriction protein
HKOGLL_19055 HKOGLL_19055 60.9 Morganella morganii S5 - Antirestriction protein
PMI_RS17350 PMI_RS17350 58.0 Proteus mirabilis HI4320 - antirestriction protein

Distribution of the homologs in the orthogroup group_97

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_97

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P75676 1.1e-36 126 51 1 124 3 yafX Uncharacterized protein YafX Escherichia coli (strain K12)
P52139 1.64e-36 125 53 1 121 3 yfjX Uncharacterized protein YfjX Escherichia coli (strain K12)
P52603 9.66e-16 72 33 3 144 2 klcA Antirestriction protein KlcA Escherichia coli
P52602 1.45e-13 66 32 4 139 3 klcA Antirestriction protein KlcA Escherichia coli
Q9S4W7 2.1e-07 50 29 3 112 3 yubI Putative antirestriction protein YubI Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_17740
Feature type CDS
Gene -
Product Antirestriction protein
Location 53481 - 53921 (strand: -1)
Length 441 (nucleotides) / 146 (amino acids)
In genomic island -

Contig

Accession ZDB_537
Length 55765 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_97
Orthogroup size 12
N. genomes 6

Actions

Genomic region

Domains

PF03230 Antirestriction protein

Protein Sequence

MTLSALSLQEPAAIKSNLVHPRGRDTFWRFYFGSVPGWQRLEGDIFKMMDNLCDVYHGAFWEFSMLTNGGAFIWPDMPETTLLLFNPHNGNDAELSPEAAGIAVCLITYSLWSFKTESPEMVEYFYQLRDYALQHEECAAIFRLID

Flanking regions ( +/- flanking 50bp)

CACAAATCAGTAATCCACTGTTTCACCCCTAAATACAAAGGAGTTTCACGATGACGTTATCAGCACTTTCGCTGCAGGAGCCTGCAGCCATCAAAAGCAATCTGGTTCATCCCCGCGGCAGAGACACATTCTGGCGGTTTTATTTCGGCAGCGTACCGGGCTGGCAGCGCCTGGAAGGCGATATTTTTAAGATGATGGATAATCTGTGTGACGTTTATCACGGTGCATTCTGGGAATTCAGCATGCTCACCAACGGTGGCGCATTTATCTGGCCGGATATGCCGGAGACCACGCTGCTTCTGTTTAATCCACATAACGGCAATGACGCAGAACTGAGCCCGGAAGCGGCCGGTATCGCGGTATGTCTCATCACTTACAGTCTCTGGTCATTTAAAACCGAAAGTCCGGAGATGGTGGAGTATTTTTATCAGTTGCGGGACTACGCCCTGCAGCATGAGGAGTGTGCTGCCATTTTCCGTCTTATCGATTAACCGGGAGCAACACCATGAAAAAGGCAACATTATCTGCGTCACCGGCGGCA