Homologs in group_1481

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08805 FBDBKF_08805 70.4 Morganella morganii S1 pyrI aspartate carbamoyltransferase regulatory subunit
EHELCC_12720 EHELCC_12720 70.4 Morganella morganii S2 pyrI aspartate carbamoyltransferase regulatory subunit
NLDBIP_13060 NLDBIP_13060 70.4 Morganella morganii S4 pyrI aspartate carbamoyltransferase regulatory subunit
LHKJJB_13495 LHKJJB_13495 70.4 Morganella morganii S3 pyrI aspartate carbamoyltransferase regulatory subunit
HKOGLL_11535 HKOGLL_11535 70.4 Morganella morganii S5 pyrI aspartate carbamoyltransferase regulatory subunit
F4V73_RS10025 F4V73_RS10025 69.1 Morganella psychrotolerans pyrI aspartate carbamoyltransferase regulatory subunit

Distribution of the homologs in the orthogroup group_1481

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1481

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2M1 3.1e-111 315 100 0 152 3 pyrI Aspartate carbamoyltransferase regulatory chain Proteus mirabilis (strain HI4320)
Q7MZ14 5.29e-81 238 73 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DJL2 9.76e-79 233 72 0 152 3 pyrI Aspartate carbamoyltransferase regulatory chain Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A6THH3 1.26e-77 230 70 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q83IL8 8.09e-77 228 69 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Shigella flexneri
Q0SXI5 8.09e-77 228 69 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Shigella flexneri serotype 5b (strain 8401)
Q6DA74 1.58e-76 227 70 0 152 3 pyrI Aspartate carbamoyltransferase regulatory chain Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P08421 1.6e-76 227 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C0Q7B7 1.6e-76 227 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella paratyphi C (strain RKS4594)
A9N658 1.6e-76 227 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T3K5 1.6e-76 227 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella newport (strain SL254)
B4TG40 1.6e-76 227 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella heidelberg (strain SL476)
B5R9J8 1.6e-76 227 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1I5 1.6e-76 227 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella enteritidis PT4 (strain P125109)
Q57GE2 1.6e-76 227 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella choleraesuis (strain SC-B67)
B5F445 1.6e-76 227 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella agona (strain SL483)
B5FSF2 2.27e-76 227 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella dublin (strain CT_02021853)
B7NUG0 3.15e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q3YUA7 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Shigella sonnei (strain Ss046)
Q31TI0 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Shigella boydii serotype 4 (strain Sb227)
B2TYZ9 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LMR7 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R310 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli (strain UTI89 / UPEC)
B1LRD1 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli (strain SMS-3-5 / SECEC)
B6I2F8 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli (strain SE11)
B7NGH7 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7F3 3.18e-76 226 68 0 151 1 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli (strain K12)
B1ISW1 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7F4 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T9E4 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJE9 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli O1:K1 / APEC
A8A802 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli O9:H4 (strain HS)
B1XEM5 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli (strain K12 / DH10B)
C4ZRB7 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli (strain K12 / MC4100 / BW2952)
B7M9K4 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli O8 (strain IAI1)
B7MSX9 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli O81 (strain ED1a)
B5Z3K2 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7F5 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli O157:H7
B7LCV5 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli (strain 55989 / EAEC)
B7MLQ2 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQQ4 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZVC6 3.18e-76 226 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8Z130 3.44e-76 226 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella typhi
B4TT82 3.44e-76 226 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella schwarzengrund (strain CVM19633)
B5BKQ8 4.05e-76 226 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella paratyphi A (strain AKU_12601)
Q5PJB3 4.05e-76 226 71 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8AMC9 4.05e-76 226 69 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7MQG1 4.67e-76 226 70 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Cronobacter sakazakii (strain ATCC BAA-894)
Q328U1 1.96e-75 224 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Shigella dysenteriae serotype 1 (strain Sd197)
A1JRD6 2.42e-75 224 68 0 152 3 pyrI Aspartate carbamoyltransferase regulatory chain Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4W604 2.88e-75 224 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Enterobacter sp. (strain 638)
B1JKJ7 3.36e-75 224 69 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665I5 3.36e-75 224 69 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K422 3.36e-75 224 69 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FDV0 4.23e-75 223 69 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q2NR34 7.08e-75 223 69 0 152 3 pyrI Aspartate carbamoyltransferase regulatory chain Sodalis glossinidius (strain morsitans)
A8G960 8.35e-75 223 68 0 152 3 pyrI Aspartate carbamoyltransferase regulatory chain Serratia proteamaculans (strain 568)
A9MEW3 1.27e-74 222 70 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4THG5 1.68e-74 222 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Yersinia pestis (strain Pestoides F)
Q1CDY2 1.68e-74 222 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1U3 1.68e-74 222 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Yersinia pestis bv. Antiqua (strain Angola)
Q1C1J6 1.68e-74 222 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Yersinia pestis bv. Antiqua (strain Antiqua)
Q8ZB38 2.05e-74 222 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Yersinia pestis
P19936 2.94e-74 221 67 0 152 3 pyrI Aspartate carbamoyltransferase regulatory chain Serratia marcescens
C5BC06 4.08e-72 216 67 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Edwardsiella ictaluri (strain 93-146)
B2VL34 9.38e-72 215 68 0 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q7MHF0 4.61e-67 203 64 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Vibrio vulnificus (strain YJ016)
Q8DCF7 1.38e-66 202 63 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Vibrio vulnificus (strain CMCP6)
C3LR52 3.8e-65 198 60 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Vibrio cholerae serotype O1 (strain M66-2)
Q9KP65 3.8e-65 198 60 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1LTK5 6.29e-65 198 65 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Baumannia cicadellinicola subsp. Homalodisca coagulata
A5F5D0 1.99e-64 196 60 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A4SHP7 6.78e-64 195 63 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Aeromonas salmonicida (strain A449)
Q87LF7 7.9e-64 195 60 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7P144 5.14e-63 193 64 0 142 3 pyrI Aspartate carbamoyltransferase regulatory chain Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A0KQG1 1.33e-62 192 62 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A7MSE1 1.59e-62 192 59 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Vibrio campbellii (strain ATCC BAA-1116)
Q6LUX1 5.29e-62 190 58 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Photobacterium profundum (strain SS9)
B5F9P8 2.31e-60 186 58 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Aliivibrio fischeri (strain MJ11)
Q5E7U6 2.31e-60 186 58 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EMC2 2.27e-59 184 56 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Aliivibrio salmonicida (strain LFI1238)
C4LBX3 1.8e-58 181 59 0 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q8K9H8 4.86e-57 177 57 1 148 3 pyrI Aspartate carbamoyltransferase regulatory chain Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P96175 3.44e-56 176 56 1 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Vibrio sp. (strain 2693)
P57451 5.5e-56 175 56 1 148 3 pyrI Aspartate carbamoyltransferase regulatory chain Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9F5 5.5e-56 175 56 1 148 3 pyrI Aspartate carbamoyltransferase regulatory chain Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D7Q7 2.57e-55 173 55 1 148 3 pyrI Aspartate carbamoyltransferase regulatory chain Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
A1SZR7 4.68e-54 170 56 1 142 3 pyrI Aspartate carbamoyltransferase regulatory chain Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q8D1W6 1.05e-51 164 53 0 152 3 pyrI Aspartate carbamoyltransferase regulatory chain Wigglesworthia glossinidia brevipalpis
Q9JWY6 1.53e-49 159 53 0 145 3 pyrI Aspartate carbamoyltransferase regulatory chain Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1KRE2 2.4e-49 158 52 0 145 3 pyrI Aspartate carbamoyltransferase regulatory chain Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9K1K9 2.4e-49 158 52 0 145 3 pyrI Aspartate carbamoyltransferase regulatory chain Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B4RPW8 4.47e-49 157 52 0 146 3 pyrI Aspartate carbamoyltransferase regulatory chain Neisseria gonorrhoeae (strain NCCP11945)
Q5F5P1 4.47e-49 157 52 0 146 3 pyrI Aspartate carbamoyltransferase regulatory chain Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q8U374 2.69e-37 127 41 2 148 3 pyrI Aspartate carbamoyltransferase regulatory chain Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P77919 3.9e-37 127 41 2 148 3 pyrI Aspartate carbamoyltransferase regulatory chain Pyrococcus abyssi (strain GE5 / Orsay)
O58452 9.84e-37 126 41 2 148 3 pyrI Aspartate carbamoyltransferase regulatory chain Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
C5A2H2 1.05e-36 126 40 2 147 3 pyrI Aspartate carbamoyltransferase regulatory chain Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
C6A1L5 3.95e-36 124 42 2 146 3 pyrI Aspartate carbamoyltransferase regulatory chain Thermococcus sibiricus (strain DSM 12597 / MM 739)
Q7MX57 1.69e-35 123 45 1 137 3 pyrI Aspartate carbamoyltransferase regulatory chain Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RL77 1.69e-35 123 45 1 137 3 pyrI Aspartate carbamoyltransferase regulatory chain Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q2NGY3 3.97e-35 122 44 2 142 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q5JHN0 6.38e-34 119 39 2 138 3 pyrI Aspartate carbamoyltransferase regulatory chain Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q3IPU7 2.95e-33 117 40 3 140 3 pyrI Aspartate carbamoyltransferase regulatory chain Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
A2BJ23 5.25e-33 117 41 3 144 3 pyrI Aspartate carbamoyltransferase regulatory chain Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
B6YXW5 9.3e-33 116 40 2 147 3 pyrI Aspartate carbamoyltransferase regulatory chain Thermococcus onnurineus (strain NA1)
Q9HHN3 1.12e-32 116 41 3 145 3 pyrI Aspartate carbamoyltransferase regulatory chain Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q8THL3 2.03e-32 115 45 5 146 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q6L0F1 4.5e-32 114 38 3 147 3 pyrI Aspartate carbamoyltransferase regulatory chain Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
O30129 8.46e-32 114 37 2 145 3 pyrI Aspartate carbamoyltransferase regulatory chain Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A6LA96 9.09e-32 114 40 1 146 3 pyrI Aspartate carbamoyltransferase regulatory chain Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q5V2T4 1.17e-31 113 40 3 142 3 pyrI Aspartate carbamoyltransferase regulatory chain Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
A3DM47 1.54e-31 113 38 3 142 3 pyrI Aspartate carbamoyltransferase regulatory chain Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1)
A3CW67 2.11e-31 113 44 3 138 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q8TVB1 2.19e-31 113 39 2 139 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
A8A8H5 1.29e-30 111 40 4 149 3 pyrI Aspartate carbamoyltransferase regulatory chain Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
A0B8L2 1.69e-30 110 41 4 149 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
O26938 2.01e-30 110 38 2 147 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q64U75 2.98e-30 110 44 1 144 3 pyrI Aspartate carbamoyltransferase regulatory chain Bacteroides fragilis (strain YCH46)
Q5LD55 2.98e-30 110 44 1 144 3 pyrI Aspartate carbamoyltransferase regulatory chain Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A1RZC6 3.52e-30 110 38 3 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Thermofilum pendens (strain DSM 2475 / Hrk 5)
Q0W5I3 5.27e-30 109 40 2 144 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
A6L5K0 6.24e-30 109 43 1 144 3 pyrI Aspartate carbamoyltransferase regulatory chain Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A5ULI9 1.1e-29 108 41 4 148 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q8PXK6 1.82e-29 108 43 5 146 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q46DA7 4.82e-29 107 42 5 146 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanosarcina barkeri (strain Fusaro / DSM 804)
A0RXJ6 7.15e-29 106 40 3 143 3 pyrI Aspartate carbamoyltransferase regulatory chain Cenarchaeum symbiosum (strain A)
Q18J06 8.5e-29 107 38 3 140 3 pyrI Aspartate carbamoyltransferase regulatory chain Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
A9A2Q6 1.27e-28 105 40 3 140 3 pyrI Aspartate carbamoyltransferase regulatory chain Nitrosopumilus maritimus (strain SCM1)
B8GF04 1.76e-28 105 38 3 138 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Q12ZN9 1.8e-28 105 39 3 143 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q8A9S4 2.16e-28 105 42 1 144 3 pyrI Aspartate carbamoyltransferase regulatory chain Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A6UPB5 1.59e-27 102 37 2 137 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
A4FX65 1.84e-27 102 36 3 139 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Q970X3 2.98e-27 102 35 3 151 3 pyrI Aspartate carbamoyltransferase regulatory chain Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q6LY87 3.4e-27 102 35 3 141 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q9HKM3 3.81e-27 102 35 3 139 3 pyrI Aspartate carbamoyltransferase regulatory chain Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
A6VG49 7.84e-27 101 36 3 139 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
A9AAK2 9.02e-27 100 36 3 139 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
A8MCA3 1.05e-26 101 38 3 142 3 pyrI Aspartate carbamoyltransferase regulatory chain Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167)
Q97B28 1.35e-26 100 36 3 146 3 pyrI Aspartate carbamoyltransferase regulatory chain Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
B1L384 1.47e-26 100 36 3 150 3 pyrI Aspartate carbamoyltransferase regulatory chain Korarchaeum cryptofilum (strain OPF8)
A1RRV1 1.54e-26 100 38 3 146 3 pyrI Aspartate carbamoyltransferase regulatory chain Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)
B1Y9W1 2.04e-26 100 37 3 146 3 pyrI Aspartate carbamoyltransferase regulatory chain Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)
Q9UX07 2.5e-26 100 35 1 148 3 pyrI Aspartate carbamoyltransferase regulatory chain Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P74766 9.16e-26 99 37 3 139 1 pyrI Aspartate carbamoyltransferase regulatory chain Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
C3NEP6 9.77e-26 98 34 3 149 3 pyrI Aspartate carbamoyltransferase regulatory chain Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3NGZ8 9.77e-26 98 34 3 149 3 pyrI Aspartate carbamoyltransferase regulatory chain Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
C3MW46 9.77e-26 98 34 3 149 3 pyrI Aspartate carbamoyltransferase regulatory chain Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C3MQG8 9.77e-26 98 34 3 149 3 pyrI Aspartate carbamoyltransferase regulatory chain Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
C4KHQ3 9.77e-26 98 34 3 149 3 pyrI Aspartate carbamoyltransferase regulatory chain Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
C3N689 9.77e-26 98 34 3 149 3 pyrI Aspartate carbamoyltransferase regulatory chain Sulfolobus islandicus (strain M.16.27)
A7I9E0 1.48e-25 98 36 4 139 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
A2SRK8 5.29e-25 96 37 3 136 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Q2FN10 2.08e-24 95 38 3 138 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
A4WLH8 5.07e-24 94 35 3 146 3 pyrI Aspartate carbamoyltransferase regulatory chain Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6)
A4YI51 7e-24 94 34 3 148 3 pyrI Aspartate carbamoyltransferase regulatory chain Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
A3MX26 1.07e-23 93 36 3 146 3 pyrI Aspartate carbamoyltransferase regulatory chain Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
Q8ZTG2 6.07e-23 91 34 3 146 3 pyrI Aspartate carbamoyltransferase regulatory chain Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q58801 8.55e-22 88 33 2 143 1 pyrI Aspartate carbamoyltransferase regulatory chain Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9YBD5 7.53e-21 86 38 2 139 3 pyrI Aspartate carbamoyltransferase regulatory chain Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
B1L1E6 1.3e-19 82 35 3 138 3 pyrI Aspartate carbamoyltransferase regulatory chain Clostridium botulinum (strain Loch Maree / Type A3)
A7GII1 1.3e-19 82 35 3 138 3 pyrI Aspartate carbamoyltransferase regulatory chain Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1INE6 1.3e-19 82 35 3 138 3 pyrI Aspartate carbamoyltransferase regulatory chain Clostridium botulinum (strain Okra / Type B1)
C1FLB5 1.3e-19 82 35 3 138 3 pyrI Aspartate carbamoyltransferase regulatory chain Clostridium botulinum (strain Kyoto / Type A2)
A5I6X0 1.3e-19 82 35 3 138 3 pyrI Aspartate carbamoyltransferase regulatory chain Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KU86 1.3e-19 82 35 3 138 3 pyrI Aspartate carbamoyltransferase regulatory chain Clostridium botulinum (strain 657 / Type Ba4)
A7FYJ1 1.3e-19 82 35 3 138 3 pyrI Aspartate carbamoyltransferase regulatory chain Clostridium botulinum (strain ATCC 19397 / Type A)
Q891I9 8.97e-19 80 34 1 140 3 pyrI Aspartate carbamoyltransferase regulatory chain Clostridium tetani (strain Massachusetts / E88)
A6UT12 1.04e-17 77 35 2 139 3 pyrI Aspartate carbamoyltransferase regulatory chain Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q8G656 3.31e-15 70 29 3 139 3 pyrI Aspartate carbamoyltransferase regulatory chain Bifidobacterium longum (strain NCC 2705)
Q97FS4 5.62e-14 68 33 4 144 3 pyrI Aspartate carbamoyltransferase regulatory chain Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P96111 1.16e-08 55 29 7 152 3 pyrBI Protein PyrBI Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17215
Feature type CDS
Gene pyrI
Product aspartate carbamoyltransferase regulatory subunit
Location 3781515 - 3781973 (strand: -1)
Length 459 (nucleotides) / 152 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1481
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01948 Aspartate carbamoyltransferase regulatory chain, allosteric domain
PF02748 Aspartate carbamoyltransferase regulatory chain, metal binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1781 Nucleotide transport and metabolism (F) F Aspartate carbamoyltransferase, regulatory subunit

Kegg Ortholog Annotation(s)

Protein Sequence

MTHDHKLKVEAIKRGTVIDHIPAQVGFKILSLFRLTETDERITVGFNLPSENLGKKDLIKIENVFLTAEQANRLAMYAPQATVNIIDDYQVVNKMALSLPELLEDVVPCPNSNCISHNEPVQSSFRVKKFASDVVLTCKYCEKEFERHAVIR

Flanking regions ( +/- flanking 50bp)

ACTTGCCTTAGTTCTAAATAAAAACTTAGTTCTTTAATAAGGAGCACACCATGACTCATGATCACAAACTAAAAGTTGAAGCTATCAAACGTGGGACTGTTATTGATCATATTCCGGCGCAGGTGGGCTTTAAGATCCTATCTCTATTTCGTTTAACCGAAACAGACGAAAGAATAACGGTAGGTTTTAATCTTCCTTCTGAAAACCTAGGTAAAAAAGATTTAATCAAAATTGAAAATGTCTTTTTAACCGCAGAGCAAGCAAATCGCTTAGCAATGTATGCCCCTCAAGCGACGGTTAATATTATTGATGACTACCAAGTCGTCAATAAAATGGCGCTAAGTTTACCTGAATTACTCGAAGATGTTGTACCCTGCCCTAATAGCAACTGTATTAGCCATAATGAGCCGGTACAAAGTAGCTTTCGCGTAAAAAAATTCGCGTCTGACGTGGTATTAACCTGCAAATATTGCGAAAAAGAATTTGAGCGCCACGCCGTTATTCGTTGATTTCTTATTGGCTATCTGCCCTGCTTGATAGGGCAGATAGTAAACACCTA