Homologs in group_1476

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08770 FBDBKF_08770 38.6 Morganella morganii S1 - YdgH/BhsA/McbA-like domain-containing protein
EHELCC_12755 EHELCC_12755 38.6 Morganella morganii S2 - YdgH/BhsA/McbA-like domain-containing protein
NLDBIP_13095 NLDBIP_13095 38.6 Morganella morganii S4 - YdgH/BhsA/McbA-like domain-containing protein
LHKJJB_13460 LHKJJB_13460 38.6 Morganella morganii S3 - YdgH/BhsA/McbA-like domain-containing protein
HKOGLL_11570 HKOGLL_11570 38.6 Morganella morganii S5 - YdgH/BhsA/McbA-like domain-containing protein
F4V73_RS09985 F4V73_RS09985 42.2 Morganella psychrotolerans - YdgH/BhsA/McbA-like domain containing protein

Distribution of the homologs in the orthogroup group_1476

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1476

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64614 2.96e-05 41 31 3 88 3 yhcN Uncharacterized protein YhcN Escherichia coli (strain K12)
P64615 2.96e-05 41 31 3 88 3 yhcN Uncharacterized protein YhcN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAX5 5.48e-05 40 37 1 86 3 ybiJ Uncharacterized protein YbiJ Shigella flexneri
P0AAX3 5.48e-05 40 37 1 86 3 ybiJ Uncharacterized protein YbiJ Escherichia coli (strain K12)
P0AAX4 5.48e-05 40 37 1 86 3 ybiJ Uncharacterized protein YbiJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAX6 0.000168 39 35 4 89 2 mcbA Uncharacterized protein McbA Escherichia coli (strain K12)
P0AAX7 0.000168 39 35 4 89 3 mcbA Uncharacterized protein McbA Escherichia coli O157:H7
P0AB40 0.000242 39 35 2 81 1 bhsA Multiple stress resistance protein BhsA Escherichia coli (strain K12)
P0AB41 0.000242 39 35 2 81 3 bhsA Multiple stress resistance protein BhsA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AB42 0.000242 39 35 2 81 3 bhsA Multiple stress resistance protein BhsA Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17175
Feature type CDS
Gene -
Product DUF1471 domain-containing protein
Location 3776242 - 3776493 (strand: 1)
Length 252 (nucleotides) / 83 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1476
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07338 YdgH/BhsA/McbA-like domain

Protein Sequence

MKKSTLIAATLALSAISFGSIAADSVATSHTSTGEYITITGNDTLDGLTTKIAQIAKDEGATGYKVIGATGDDYLTVNAEIYR

Flanking regions ( +/- flanking 50bp)

AGACACACTCCGCGATAGATAACAAATTTAGAATTTAATTGGAGTTCATCATGAAAAAATCTACATTAATCGCTGCAACATTAGCTTTAAGTGCTATTTCATTCGGTTCAATCGCTGCTGACAGCGTAGCAACTAGCCATACCTCTACTGGTGAGTATATCACAATTACAGGTAACGATACTTTAGATGGCTTAACAACTAAAATTGCACAAATCGCAAAAGATGAAGGCGCAACTGGTTATAAAGTTATCGGTGCTACAGGTGACGATTATCTGACTGTAAATGCGGAAATTTATCGTTAATTTATAATTATTCTCGATAAGTTACCTGCACAAAGAGACACGCGGTAAGA