Homologs in group_1476

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08770 FBDBKF_08770 90.4 Morganella morganii S1 - YdgH/BhsA/McbA-like domain-containing protein
EHELCC_12755 EHELCC_12755 90.4 Morganella morganii S2 - YdgH/BhsA/McbA-like domain-containing protein
NLDBIP_13095 NLDBIP_13095 90.4 Morganella morganii S4 - YdgH/BhsA/McbA-like domain-containing protein
LHKJJB_13460 LHKJJB_13460 90.4 Morganella morganii S3 - YdgH/BhsA/McbA-like domain-containing protein
HKOGLL_11570 HKOGLL_11570 90.4 Morganella morganii S5 - YdgH/BhsA/McbA-like domain-containing protein
PMI_RS17175 PMI_RS17175 42.2 Proteus mirabilis HI4320 - DUF1471 domain-containing protein

Distribution of the homologs in the orthogroup group_1476

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1476

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AB40 9.42e-12 58 43 1 85 1 bhsA Multiple stress resistance protein BhsA Escherichia coli (strain K12)
P0AB41 9.42e-12 58 43 1 85 3 bhsA Multiple stress resistance protein BhsA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AB42 9.42e-12 58 43 1 85 3 bhsA Multiple stress resistance protein BhsA Escherichia coli O157:H7
P64614 6.84e-08 48 36 2 87 3 yhcN Uncharacterized protein YhcN Escherichia coli (strain K12)
P64615 6.84e-08 48 36 2 87 3 yhcN Uncharacterized protein YhcN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAX6 1.85e-07 47 34 1 82 2 mcbA Uncharacterized protein McbA Escherichia coli (strain K12)
P0AAX7 1.85e-07 47 34 1 82 3 mcbA Uncharacterized protein McbA Escherichia coli O157:H7
P0AAX5 0.000106 40 43 2 87 3 ybiJ Uncharacterized protein YbiJ Shigella flexneri
P0AAX3 0.000106 40 43 2 87 3 ybiJ Uncharacterized protein YbiJ Escherichia coli (strain K12)
P0AAX4 0.000106 40 43 2 87 3 ybiJ Uncharacterized protein YbiJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09985
Feature type CDS
Gene -
Product YdgH/BhsA/McbA-like domain containing protein
Location 102912 - 103163 (strand: 1)
Length 252 (nucleotides) / 83 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1476
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07338 YdgH/BhsA/McbA-like domain

Protein Sequence

MKMSAIIPAVLALSAVSFGSMAATEVQTSTQAPAGVVSVSNVDTLANVTAALSKKADEAGATSFRIISAGGENLMTGTAEIYK

Flanking regions ( +/- flanking 50bp)

AGAGACTAAAAACGTCTCACGATATTATTAAAATTCTAAGGAATCATATTATGAAAATGTCTGCAATCATCCCTGCTGTTTTAGCGTTAAGTGCTGTTTCATTTGGTTCAATGGCTGCAACTGAAGTACAAACCAGCACTCAGGCTCCGGCTGGAGTTGTGTCTGTCAGCAATGTTGACACCCTGGCAAATGTAACTGCCGCTTTATCCAAAAAAGCTGATGAAGCCGGTGCGACTTCTTTCCGTATTATCTCCGCTGGTGGTGAAAACCTGATGACGGGTACTGCGGAAATTTATAAATAATCACTGAAGTCTGCCATAAAACAGCCCGGATATCCGGGACTGTCTGAACC