Homologs in group_1379

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08525 FBDBKF_08525 73.5 Morganella morganii S1 - DUF1107 domain-containing protein
EHELCC_13000 EHELCC_13000 73.5 Morganella morganii S2 - DUF1107 domain-containing protein
NLDBIP_13340 NLDBIP_13340 73.5 Morganella morganii S4 - DUF1107 domain-containing protein
LHKJJB_13215 LHKJJB_13215 73.5 Morganella morganii S3 - DUF1107 domain-containing protein
HKOGLL_11815 HKOGLL_11815 73.5 Morganella morganii S5 - DUF1107 domain-containing protein
F4V73_RS09750 F4V73_RS09750 73.1 Morganella psychrotolerans - DUF1107 domain-containing protein

Distribution of the homologs in the orthogroup group_1379

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1379

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADE2 5.16e-30 103 70 0 68 4 ytfK Uncharacterized protein YtfK Escherichia coli (strain K12)
P0ADE3 5.16e-30 103 70 0 68 4 ytfK Uncharacterized protein YtfK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16860
Feature type CDS
Gene -
Product DUF1107 domain-containing protein
Location 3712406 - 3712612 (strand: 1)
Length 207 (nucleotides) / 68 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1379
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06526 Protein of unknown function (DUF1107)

Protein Sequence

MKIFNRYNPEKIALYVKTLFRGRFYIKGMGAFEFDYGKILLPKIKDKLHFNVMSEVNQQVVLLKAEMG

Flanking regions ( +/- flanking 50bp)

TCTTTATGACTGATTAAATTCACAACTGAGCATGGGAGACTAACTGAAAGATGAAGATCTTCAATCGCTATAACCCAGAAAAAATTGCTCTCTACGTTAAGACGTTATTTCGTGGACGGTTTTATATCAAAGGAATGGGCGCATTTGAGTTCGATTACGGTAAAATTTTATTGCCGAAAATAAAAGATAAGCTGCATTTTAATGTGATGAGTGAAGTTAACCAGCAGGTGGTTTTACTCAAAGCTGAAATGGGCTAACTTTTATCTGATAGATAACTGAGTCTATATCTTGTGCTTTTACGATAAGA