Homologs in group_1435

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08525 FBDBKF_08525 100.0 Morganella morganii S1 - DUF1107 domain-containing protein
EHELCC_13000 EHELCC_13000 100.0 Morganella morganii S2 - DUF1107 domain-containing protein
LHKJJB_13215 LHKJJB_13215 100.0 Morganella morganii S3 - DUF1107 domain-containing protein
HKOGLL_11815 HKOGLL_11815 100.0 Morganella morganii S5 - DUF1107 domain-containing protein
F4V73_RS09750 F4V73_RS09750 94.0 Morganella psychrotolerans - DUF1107 domain-containing protein
PMI_RS16860 PMI_RS16860 73.5 Proteus mirabilis HI4320 - DUF1107 domain-containing protein

Distribution of the homologs in the orthogroup group_1435

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1435

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADE2 3.25e-30 103 69 0 68 4 ytfK Uncharacterized protein YtfK Escherichia coli (strain K12)
P0ADE3 3.25e-30 103 69 0 68 4 ytfK Uncharacterized protein YtfK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_13340
Feature type CDS
Gene -
Product DUF1107 domain-containing protein
Location 78239 - 78445 (strand: -1)
Length 207 (nucleotides) / 68 (amino acids)
In genomic island -

Contig

Accession ZDB_528
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1435
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06526 Protein of unknown function (DUF1107)

Protein Sequence

MKIFARYNPAQIARYVKTLFRGRLYIQGMGAFEFDYGKILPPKIRDKRHLSAMSEINQQVSLLQAQLA

Flanking regions ( +/- flanking 50bp)

AGTCATACCTTAGGCATGAAAGAAAAGGTAAAGGGGAGGACATAAGTACGATGAAAATTTTCGCCCGTTACAACCCGGCTCAGATCGCCCGCTACGTGAAAACCTTATTCCGTGGCCGCCTGTATATACAGGGGATGGGCGCGTTTGAATTTGACTACGGCAAGATTTTACCGCCGAAAATCAGAGACAAACGCCACCTGAGTGCAATGAGTGAAATTAATCAGCAGGTATCGTTGCTGCAGGCGCAGCTGGCGTAACCACAATACCTGTCTGATGAAGAAGGGTTAGTTTTACGGTTTCTGGTGCT