Homologs in group_2410

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19135 FBDBKF_19135 92.4 Morganella morganii S1 rpsM 30S ribosomal protein S13
EHELCC_18880 EHELCC_18880 92.4 Morganella morganii S2 rpsM 30S ribosomal protein S13
NLDBIP_18895 NLDBIP_18895 92.4 Morganella morganii S4 rpsM 30S ribosomal protein S13
LHKJJB_18750 LHKJJB_18750 92.4 Morganella morganii S3 rpsM 30S ribosomal protein S13
HKOGLL_18485 HKOGLL_18485 92.4 Morganella morganii S5 rpsM 30S ribosomal protein S13
F4V73_RS19030 F4V73_RS19030 93.2 Morganella psychrotolerans rpsM 30S ribosomal protein S13

Distribution of the homologs in the orthogroup group_2410

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2410

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C6DFS6 3.41e-79 231 96 0 118 3 rpsM Small ribosomal subunit protein uS13 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZZ2 7.53e-79 230 96 0 118 3 rpsM Small ribosomal subunit protein uS13 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7MYH2 5.93e-78 228 96 0 118 3 rpsM Small ribosomal subunit protein uS13 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JS04 1.4e-77 227 95 0 118 3 rpsM Small ribosomal subunit protein uS13 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JIY3 3.84e-76 223 94 0 118 3 rpsM Small ribosomal subunit protein uS13 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664U3 3.84e-76 223 94 0 118 3 rpsM Small ribosomal subunit protein uS13 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH12 3.84e-76 223 94 0 118 3 rpsM Small ribosomal subunit protein uS13 Yersinia pestis (strain Pestoides F)
Q1CCW5 3.84e-76 223 94 0 118 3 rpsM Small ribosomal subunit protein uS13 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R915 3.84e-76 223 94 0 118 3 rpsM Small ribosomal subunit protein uS13 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ90 3.84e-76 223 94 0 118 3 rpsM Small ribosomal subunit protein uS13 Yersinia pestis
B2K515 3.84e-76 223 94 0 118 3 rpsM Small ribosomal subunit protein uS13 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2W8 3.84e-76 223 94 0 118 3 rpsM Small ribosomal subunit protein uS13 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNL3 3.84e-76 223 94 0 118 3 rpsM Small ribosomal subunit protein uS13 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VK74 9.34e-76 222 92 0 118 3 rpsM Small ribosomal subunit protein uS13 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q65QX7 1.04e-75 222 92 0 118 3 rpsM Small ribosomal subunit protein uS13 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q2NQP4 2.56e-75 221 93 0 118 3 rpsM Small ribosomal subunit protein uS13 Sodalis glossinidius (strain morsitans)
Q9CL51 4.02e-75 221 91 0 118 3 rpsM Small ribosomal subunit protein uS13 Pasteurella multocida (strain Pm70)
A8GKH6 6.31e-75 220 90 0 118 3 rpsM Small ribosomal subunit protein uS13 Serratia proteamaculans (strain 568)
C5BF29 8.96e-75 220 91 0 118 3 rpsM Small ribosomal subunit protein uS13 Edwardsiella ictaluri (strain 93-146)
A6TEV1 2.87e-73 216 89 0 118 3 rpsM Small ribosomal subunit protein uS13 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNB4 2.87e-73 216 89 0 118 3 rpsM Small ribosomal subunit protein uS13 Klebsiella pneumoniae (strain 342)
Q8ZLM1 7.72e-73 215 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PK07 7.72e-73 215 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A5UHV2 2.12e-72 214 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Haemophilus influenzae (strain PittGG)
A5UDS5 2.12e-72 214 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Haemophilus influenzae (strain PittEE)
Q4QMA0 2.12e-72 214 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Haemophilus influenzae (strain 86-028NP)
Q3YWW1 6.49e-72 213 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Shigella sonnei (strain Ss046)
P0A7T2 6.49e-72 213 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Shigella flexneri
Q0T004 6.49e-72 213 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Shigella flexneri serotype 5b (strain 8401)
Q32B53 6.49e-72 213 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VX8 6.49e-72 213 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Shigella boydii serotype 4 (strain Sb227)
Q1R633 6.49e-72 213 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Escherichia coli (strain UTI89 / UPEC)
P0A7S9 6.49e-72 213 88 0 118 1 rpsM Small ribosomal subunit protein uS13 Escherichia coli (strain K12)
P0A7T0 6.49e-72 213 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCG3 6.49e-72 213 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGI9 6.49e-72 213 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Escherichia coli O1:K1 / APEC
P0A7T1 6.49e-72 213 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Escherichia coli O157:H7
Q7VKF5 1.17e-71 212 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8Z1X6 1.46e-71 212 88 0 118 3 rpsM Small ribosomal subunit protein uS13 Salmonella typhi
Q0I140 3.59e-71 211 87 0 118 3 rpsM Small ribosomal subunit protein uS13 Histophilus somni (strain 129Pt)
A3N379 4.06e-70 208 86 0 118 3 rpsM Small ribosomal subunit protein uS13 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A1S240 1.14e-68 204 83 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q9KP05 3.35e-68 203 84 0 118 3 rpsM Small ribosomal subunit protein uS13 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B8CNF5 3.42e-68 203 82 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8GYZ7 3.42e-68 203 82 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TLZ1 3.42e-68 203 82 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella halifaxensis (strain HAW-EB4)
Q87SZ2 3.86e-68 203 84 0 118 3 rpsM Small ribosomal subunit protein uS13 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q5E892 5.36e-68 202 84 0 118 3 rpsM Small ribosomal subunit protein uS13 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q0I083 1.94e-67 201 81 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella sp. (strain MR-7)
Q0HNR5 1.94e-67 201 81 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella sp. (strain MR-4)
A0KRP6 1.94e-67 201 81 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella sp. (strain ANA-3)
Q8EK48 1.94e-67 201 81 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7MPG7 2.52e-67 201 83 0 118 3 rpsM Small ribosomal subunit protein uS13 Vibrio vulnificus (strain YJ016)
Q8DE61 2.52e-67 201 83 0 118 3 rpsM Small ribosomal subunit protein uS13 Vibrio vulnificus (strain CMCP6)
A3Q9A4 3.46e-67 201 81 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q15X51 3.66e-67 201 78 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A1RED6 4.61e-67 200 80 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella sp. (strain W3-18-1)
A4YBW1 4.61e-67 200 80 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q1LTB6 4.92e-67 200 82 0 118 3 rpsM Small ribosomal subunit protein uS13 Baumannia cicadellinicola subsp. Homalodisca coagulata
A9KWC3 5.8e-67 200 80 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella baltica (strain OS195)
A6WHV0 5.8e-67 200 80 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella baltica (strain OS185)
A3DA50 5.8e-67 200 80 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBI3 5.8e-67 200 80 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella baltica (strain OS223)
Q089N2 3.43e-66 198 79 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella frigidimarina (strain NCIMB 400)
P44380 3.46e-66 198 88 0 110 3 rpsM Small ribosomal subunit protein uS13 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C4K796 3.67e-66 198 82 0 118 3 rpsM Small ribosomal subunit protein uS13 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q6LV94 7.16e-66 197 81 0 118 3 rpsM Small ribosomal subunit protein uS13 Photobacterium profundum (strain SS9)
Q12ST7 7.4e-66 197 79 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
C4L7V2 8.72e-66 197 78 0 118 3 rpsM Small ribosomal subunit protein uS13 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B1KMW1 1.19e-65 197 78 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella woodyi (strain ATCC 51908 / MS32)
A4SSY4 1.7e-65 196 77 0 118 3 rpsM Small ribosomal subunit protein uS13 Aeromonas salmonicida (strain A449)
A0KF42 1.7e-65 196 77 0 118 3 rpsM Small ribosomal subunit protein uS13 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q3IJK6 2.22e-65 196 81 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudoalteromonas translucida (strain TAC 125)
Q21M36 1.38e-64 194 74 0 118 3 rpsM Small ribosomal subunit protein uS13 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B4RT50 1.82e-64 194 76 0 118 3 rpsM Small ribosomal subunit protein uS13 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q9S0R1 1.92e-64 194 78 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
A8G1C8 3.8e-64 193 77 0 118 3 rpsM Small ribosomal subunit protein uS13 Shewanella sediminis (strain HAW-EB3)
Q5QXV5 5.34e-64 192 76 0 118 3 rpsM Small ribosomal subunit protein uS13 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q488Z1 5.76e-64 192 78 0 118 3 rpsM Small ribosomal subunit protein uS13 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1SXW5 7.26e-64 192 77 0 118 3 rpsM1 Small ribosomal subunit protein uS13 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A6UZL0 4.58e-63 190 75 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas aeruginosa (strain PA7)
Q9HWF7 6.37e-63 190 75 0 118 1 rpsM Small ribosomal subunit protein uS13 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T58 6.37e-63 190 75 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V665 6.37e-63 190 75 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas aeruginosa (strain LESB58)
A6W370 1.34e-62 189 76 0 118 3 rpsM Small ribosomal subunit protein uS13 Marinomonas sp. (strain MWYL1)
B3PK59 1.73e-62 189 75 0 118 3 rpsM Small ribosomal subunit protein uS13 Cellvibrio japonicus (strain Ueda107)
Q1R0F3 1.75e-62 189 74 0 118 3 rpsM Small ribosomal subunit protein uS13 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q605D4 2.11e-62 189 73 0 118 3 rpsM Small ribosomal subunit protein uS13 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B8GV36 2.13e-62 189 72 0 118 3 rpsM Small ribosomal subunit protein uS13 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
C1DKN5 3.19e-62 188 76 0 118 3 rpsM Small ribosomal subunit protein uS13 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A4VHQ2 4.02e-62 188 74 0 118 3 rpsM Small ribosomal subunit protein uS13 Stutzerimonas stutzeri (strain A1501)
C5BQ83 7.11e-62 187 72 0 118 3 rpsM Small ribosomal subunit protein uS13 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q4ZMR5 7.11e-62 187 74 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas syringae pv. syringae (strain B728a)
Q889U9 7.11e-62 187 74 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48D58 7.11e-62 187 74 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B0U0W8 7.6e-62 187 76 0 117 3 rpsM Small ribosomal subunit protein uS13 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A4IZR2 9.99e-62 187 76 0 117 3 rpsM Small ribosomal subunit protein uS13 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHU6 9.99e-62 187 76 0 117 3 rpsM Small ribosomal subunit protein uS13 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNQ6 9.99e-62 187 76 0 117 3 rpsM Small ribosomal subunit protein uS13 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4K5 9.99e-62 187 76 0 117 3 rpsM Small ribosomal subunit protein uS13 Francisella tularensis subsp. novicida (strain U112)
B2SDW3 9.99e-62 187 76 0 117 3 rpsM Small ribosomal subunit protein uS13 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5E8 9.99e-62 187 76 0 117 3 rpsM Small ribosomal subunit protein uS13 Francisella tularensis subsp. holarctica (strain LVS)
A7N9U6 9.99e-62 187 76 0 117 3 rpsM Small ribosomal subunit protein uS13 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14J98 9.99e-62 187 76 0 117 3 rpsM Small ribosomal subunit protein uS13 Francisella tularensis subsp. tularensis (strain FSC 198)
Q4K554 3.09e-61 186 73 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3K609 4.35e-61 185 73 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas fluorescens (strain Pf0-1)
Q47J80 6.16e-61 185 71 0 116 3 rpsM Small ribosomal subunit protein uS13 Dechloromonas aromatica (strain RCB)
Q3SLM7 9.16e-61 184 72 0 118 3 rpsM Small ribosomal subunit protein uS13 Thiobacillus denitrificans (strain ATCC 25259)
C3K2V4 2.2e-60 183 73 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas fluorescens (strain SBW25)
Q1H4L4 4.74e-60 182 73 0 117 3 rpsM Small ribosomal subunit protein uS13 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A1KB04 4.84e-60 182 71 0 116 3 rpsM Small ribosomal subunit protein uS13 Azoarcus sp. (strain BH72)
A4XZ68 4.91e-60 182 73 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas mendocina (strain ymp)
Q8K971 5.42e-60 182 77 0 118 3 rpsM Small ribosomal subunit protein uS13 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q0VSI1 7.12e-60 182 70 0 118 3 rpsM Small ribosomal subunit protein uS13 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q2YAX5 1.82e-59 181 70 0 117 3 rpsM Small ribosomal subunit protein uS13 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q2S934 2.6e-59 181 72 0 118 3 rpsM Small ribosomal subunit protein uS13 Hahella chejuensis (strain KCTC 2396)
Q5P310 3.06e-59 181 69 0 116 3 rpsM Small ribosomal subunit protein uS13 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B1JAJ0 3.65e-59 180 72 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas putida (strain W619)
Q88QL3 6.25e-59 180 71 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK88 6.25e-59 180 71 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas putida (strain GB-1)
A5VXR9 6.25e-59 180 71 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IFU4 6.25e-59 180 71 0 118 3 rpsM Small ribosomal subunit protein uS13 Pseudomonas entomophila (strain L48)
A1TYL9 6.39e-59 180 69 0 118 3 rpsM Small ribosomal subunit protein uS13 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A4SUY3 8.56e-59 179 71 0 114 3 rpsM Small ribosomal subunit protein uS13 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q7VQC6 1.15e-58 179 72 0 118 3 rpsM Small ribosomal subunit protein uS13 Blochmanniella floridana
B8D827 1.71e-58 179 75 0 118 3 rpsM Small ribosomal subunit protein uS13 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57569 1.71e-58 179 75 0 118 3 rpsM Small ribosomal subunit protein uS13 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9S5 1.71e-58 179 75 0 118 3 rpsM Small ribosomal subunit protein uS13 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A4G9R6 2.65e-58 178 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Herminiimonas arsenicoxydans
Q493I7 2.77e-58 178 72 0 118 3 rpsM Small ribosomal subunit protein uS13 Blochmanniella pennsylvanica (strain BPEN)
B2FQK5 8.31e-58 177 69 0 118 3 rpsM Small ribosomal subunit protein uS13 Stenotrophomonas maltophilia (strain K279a)
C1DAU0 1.5e-57 176 67 0 116 3 rpsM Small ribosomal subunit protein uS13 Laribacter hongkongensis (strain HLHK9)
A1KRJ6 1.69e-57 176 71 0 116 3 rpsM Small ribosomal subunit protein uS13 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66386 1.69e-57 176 71 0 116 3 rpsM Small ribosomal subunit protein uS13 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66385 1.69e-57 176 71 0 116 3 rpsM Small ribosomal subunit protein uS13 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3U3 1.69e-57 176 71 0 116 3 rpsM Small ribosomal subunit protein uS13 Neisseria meningitidis serogroup C (strain 053442)
Q5F5U9 1.69e-57 176 71 0 116 3 rpsM Small ribosomal subunit protein uS13 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4SLH2 2.57e-57 176 68 0 118 3 rpsM Small ribosomal subunit protein uS13 Stenotrophomonas maltophilia (strain R551-3)
A6T3I1 3.12e-57 176 66 0 114 3 rpsM Small ribosomal subunit protein uS13 Janthinobacterium sp. (strain Marseille)
B2UEJ6 4.74e-57 175 70 0 114 3 rpsM Small ribosomal subunit protein uS13 Ralstonia pickettii (strain 12J)
B1XSS4 4.74e-57 175 71 0 114 3 rpsM Small ribosomal subunit protein uS13 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q5GWV6 6.32e-57 175 68 0 118 3 rpsM Small ribosomal subunit protein uS13 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQT1 6.32e-57 175 68 0 118 3 rpsM Small ribosomal subunit protein uS13 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P006 6.32e-57 175 68 0 118 3 rpsM Small ribosomal subunit protein uS13 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BWW2 6.32e-57 175 68 0 118 3 rpsM Small ribosomal subunit protein uS13 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B0RU61 6.32e-57 175 68 0 118 3 rpsM Small ribosomal subunit protein uS13 Xanthomonas campestris pv. campestris (strain B100)
Q4URG0 6.32e-57 175 68 0 118 3 rpsM Small ribosomal subunit protein uS13 Xanthomonas campestris pv. campestris (strain 8004)
Q8NKX3 6.32e-57 175 68 0 118 3 rpsM Small ribosomal subunit protein uS13 Xanthomonas axonopodis pv. citri (strain 306)
Q7NQH4 7.44e-57 174 65 0 116 3 rpsM Small ribosomal subunit protein uS13 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A1W330 1.73e-56 174 68 0 114 3 rpsM Small ribosomal subunit protein uS13 Acidovorax sp. (strain JS42)
B9MBV9 1.73e-56 174 68 0 114 3 rpsM Small ribosomal subunit protein uS13 Acidovorax ebreus (strain TPSY)
Q2SU50 2.37e-56 173 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q34 2.48e-56 173 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia pseudomallei (strain K96243)
A3NEF6 2.48e-56 173 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia pseudomallei (strain 668)
Q3JMT6 2.48e-56 173 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia pseudomallei (strain 1710b)
A3P090 2.48e-56 173 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia pseudomallei (strain 1106a)
A1V880 2.48e-56 173 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia mallei (strain SAVP1)
Q62GM8 2.48e-56 173 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia mallei (strain ATCC 23344)
A2S7J9 2.48e-56 173 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia mallei (strain NCTC 10229)
A3MRX7 2.48e-56 173 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia mallei (strain NCTC 10247)
B3R7E6 2.68e-56 173 69 0 114 3 rpsM Small ribosomal subunit protein uS13 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q1LI60 2.68e-56 173 69 0 114 3 rpsM Small ribosomal subunit protein uS13 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q89A87 3.17e-56 173 71 0 118 3 rpsM Small ribosomal subunit protein uS13 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q0K642 3.3e-56 173 68 0 114 3 rpsM Small ribosomal subunit protein uS13 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8XV35 3.76e-56 173 69 0 114 3 rpsM Small ribosomal subunit protein uS13 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q46WG6 4.2e-56 173 68 0 114 3 rpsM Small ribosomal subunit protein uS13 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q3J8T5 6.68e-56 172 70 0 118 3 rpsM Small ribosomal subunit protein uS13 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A4JAR3 6.95e-56 172 66 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BJ23 6.95e-56 172 66 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRQ2 6.95e-56 172 66 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia ambifaria (strain MC40-6)
Q5WZJ0 7.79e-56 172 72 0 114 3 rpsM Small ribosomal subunit protein uS13 Legionella pneumophila (strain Lens)
Q5ZYM1 7.79e-56 172 72 0 114 3 rpsM Small ribosomal subunit protein uS13 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHP4 7.79e-56 172 72 0 114 3 rpsM Small ribosomal subunit protein uS13 Legionella pneumophila (strain Corby)
Q5X837 7.79e-56 172 72 0 114 3 rpsM Small ribosomal subunit protein uS13 Legionella pneumophila (strain Paris)
Q9Z3F0 9.38e-56 172 67 0 118 3 rpsM Small ribosomal subunit protein uS13 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0V6U4 1.25e-55 171 70 0 118 3 rpsM Small ribosomal subunit protein uS13 Acinetobacter baumannii (strain AYE)
A3M962 1.25e-55 171 70 0 118 3 rpsM Small ribosomal subunit protein uS13 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQU0 1.25e-55 171 70 0 118 3 rpsM Small ribosomal subunit protein uS13 Acinetobacter baumannii (strain SDF)
B2HZ86 1.25e-55 171 70 0 118 3 rpsM Small ribosomal subunit protein uS13 Acinetobacter baumannii (strain ACICU)
B7IA17 1.25e-55 171 70 0 118 1 rpsM Small ribosomal subunit protein uS13 Acinetobacter baumannii (strain AB0057)
B7GW24 1.25e-55 171 70 0 118 3 rpsM Small ribosomal subunit protein uS13 Acinetobacter baumannii (strain AB307-0294)
A9ADL6 1.45e-55 171 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia multivorans (strain ATCC 17616 / 249)
B4E5E3 1.45e-55 171 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q13TJ3 1.8e-55 171 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Paraburkholderia xenovorans (strain LB400)
B2JI42 1.8e-55 171 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q1BRX1 2.2e-55 171 66 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia orbicola (strain AU 1054)
B1JU45 2.2e-55 171 66 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia orbicola (strain MC0-3)
Q39KE4 2.2e-55 171 66 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A0K3P8 2.2e-55 171 66 0 114 3 rpsM Small ribosomal subunit protein uS13 Burkholderia cenocepacia (strain HI2424)
B2T728 2.59e-55 171 66 0 114 3 rpsM Small ribosomal subunit protein uS13 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q6F7T4 6.75e-55 169 68 0 118 3 rpsM Small ribosomal subunit protein uS13 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A5EX97 8.98e-55 169 66 0 118 3 rpsM Small ribosomal subunit protein uS13 Dichelobacter nodosus (strain VCS1703A)
A1TJT9 9.14e-55 169 66 0 114 3 rpsM Small ribosomal subunit protein uS13 Paracidovorax citrulli (strain AAC00-1)
B1Y8B4 1.3e-54 169 67 0 114 3 rpsM Small ribosomal subunit protein uS13 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q1QDG4 1.96e-54 168 64 0 118 3 rpsM Small ribosomal subunit protein uS13 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
C5CQ78 1.99e-54 169 66 0 114 3 rpsM Small ribosomal subunit protein uS13 Variovorax paradoxus (strain S110)
Q4FUD4 5.36e-54 167 63 0 118 3 rpsM Small ribosomal subunit protein uS13 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q9PE55 5.92e-54 167 68 0 118 3 rpsM Small ribosomal subunit protein uS13 Xylella fastidiosa (strain 9a5c)
A1WVA0 9.89e-54 167 65 0 114 3 rpsM Small ribosomal subunit protein uS13 Halorhodospira halophila (strain DSM 244 / SL1)
Q31IW1 1.41e-53 166 65 0 118 3 rpsM Small ribosomal subunit protein uS13 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q0ABF3 1.97e-53 166 65 0 114 3 rpsM Small ribosomal subunit protein uS13 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q87E61 2.25e-53 166 67 0 118 3 rpsM Small ribosomal subunit protein uS13 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8J0 2.25e-53 166 67 0 118 3 rpsM Small ribosomal subunit protein uS13 Xylella fastidiosa (strain M23)
Q21QP6 5.96e-53 165 63 0 114 3 rpsM Small ribosomal subunit protein uS13 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B0U5M0 6.82e-53 164 67 0 118 3 rpsM Small ribosomal subunit protein uS13 Xylella fastidiosa (strain M12)
A2SLD4 1.58e-52 164 66 0 114 3 rpsM Small ribosomal subunit protein uS13 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A9BRX2 1.69e-52 164 66 0 114 3 rpsM Small ribosomal subunit protein uS13 Delftia acidovorans (strain DSM 14801 / SPH-1)
A1WK95 2.19e-52 163 64 0 114 3 rpsM Small ribosomal subunit protein uS13 Verminephrobacter eiseniae (strain EF01-2)
Q12G80 4.14e-52 162 64 0 114 3 rpsM Small ribosomal subunit protein uS13 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q057C6 4.2e-52 162 67 0 117 3 rpsM Small ribosomal subunit protein uS13 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B5EM96 5.48e-52 162 64 0 118 3 rpsM Small ribosomal subunit protein uS13 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J4A1 5.48e-52 162 64 0 118 3 rpsM Small ribosomal subunit protein uS13 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q8D1Z0 9.79e-52 162 66 0 118 3 rpsM Small ribosomal subunit protein uS13 Wigglesworthia glossinidia brevipalpis
A1VJ37 1.19e-51 161 64 0 114 3 rpsM Small ribosomal subunit protein uS13 Polaromonas naphthalenivorans (strain CJ2)
Q2RQY2 1.88e-51 161 65 1 117 3 rpsM Small ribosomal subunit protein uS13 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q0AIH4 2.06e-51 161 64 0 117 3 rpsM Small ribosomal subunit protein uS13 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A5WCL1 2.9e-51 160 63 0 118 3 rpsM Small ribosomal subunit protein uS13 Psychrobacter sp. (strain PRwf-1)
P59755 2.96e-51 160 64 0 116 3 rpsM Small ribosomal subunit protein uS13 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q7VTA8 5.39e-51 160 63 0 114 3 rpsM Small ribosomal subunit protein uS13 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2D2 5.39e-51 160 63 0 114 3 rpsM Small ribosomal subunit protein uS13 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRA0 5.39e-51 160 63 0 114 3 rpsM Small ribosomal subunit protein uS13 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2L248 1.59e-50 159 62 0 114 3 rpsM Small ribosomal subunit protein uS13 Bordetella avium (strain 197N)
A9IHS0 2.07e-50 158 63 0 114 3 rpsM Small ribosomal subunit protein uS13 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1AVM2 4.59e-50 157 64 0 117 3 rpsM Small ribosomal subunit protein uS13 Ruthia magnifica subsp. Calyptogena magnifica
Q8EUD6 4.2e-49 155 62 0 116 3 rpsM Small ribosomal subunit protein uS13 Malacoplasma penetrans (strain HF-2)
A5CXI6 4.68e-48 152 62 0 117 3 rpsM Small ribosomal subunit protein uS13 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q04BZ1 5.72e-48 152 64 0 114 3 rpsM Small ribosomal subunit protein uS13 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBJ4 5.72e-48 152 64 0 114 3 rpsM Small ribosomal subunit protein uS13 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A9NAZ2 7e-48 152 62 0 116 3 rpsM Small ribosomal subunit protein uS13 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD09 7e-48 152 62 0 116 3 rpsM Small ribosomal subunit protein uS13 Coxiella burnetii (strain Dugway 5J108-111)
B6J241 7e-48 152 62 0 116 3 rpsM Small ribosomal subunit protein uS13 Coxiella burnetii (strain CbuG_Q212)
B6J5F4 7e-48 152 62 0 116 3 rpsM Small ribosomal subunit protein uS13 Coxiella burnetii (strain CbuK_Q154)
B1HMV7 2.4e-47 150 57 0 116 3 rpsM Small ribosomal subunit protein uS13 Lysinibacillus sphaericus (strain C3-41)
B1YGX5 2.4e-47 150 60 0 116 3 rpsM Small ribosomal subunit protein uS13 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
P59753 3.21e-47 150 62 0 116 3 rpsM Small ribosomal subunit protein uS13 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q5LW34 3.48e-47 150 65 1 117 3 rpsM Small ribosomal subunit protein uS13 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q65P81 4.25e-47 150 59 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A5IYW1 4.42e-47 150 60 0 116 3 rpsM Small ribosomal subunit protein uS13 Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
A5D5E5 4.47e-47 150 64 1 117 3 rpsM Small ribosomal subunit protein uS13 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q2RFS3 5.33e-47 150 61 1 117 3 rpsM Small ribosomal subunit protein uS13 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8ETW0 8.11e-47 149 58 0 116 3 rpsM Small ribosomal subunit protein uS13 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A7HWT3 1.17e-46 149 61 1 117 3 rpsM Small ribosomal subunit protein uS13 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B7GJ92 1.18e-46 149 61 0 116 3 rpsM Small ribosomal subunit protein uS13 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A1ALW4 1.4e-46 149 61 1 117 3 rpsM Small ribosomal subunit protein uS13 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A4IJL2 2.13e-46 148 60 0 116 3 rpsM Small ribosomal subunit protein uS13 Geobacillus thermodenitrificans (strain NG80-2)
Q5L3R4 2.13e-46 148 60 0 116 3 rpsM Small ribosomal subunit protein uS13 Geobacillus kaustophilus (strain HTA426)
A7Z0R3 2.71e-46 148 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P20282 2.77e-46 148 57 0 116 1 rpsM Small ribosomal subunit protein uS13 Bacillus subtilis (strain 168)
Q74L66 3.64e-46 147 60 0 114 3 rpsM Small ribosomal subunit protein uS13 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q046A2 3.64e-46 147 60 0 114 3 rpsM Small ribosomal subunit protein uS13 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q2SRH7 4.38e-46 147 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
A9FGC9 4.53e-46 147 62 1 115 3 rpsM Small ribosomal subunit protein uS13 Sorangium cellulosum (strain So ce56)
A8F9B0 4.63e-46 147 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus pumilus (strain SAFR-032)
Q16AC0 4.72e-46 147 63 1 117 3 rpsM Small ribosomal subunit protein uS13 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A4J136 4.87e-46 147 62 1 117 3 rpsM Small ribosomal subunit protein uS13 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
C5CC38 6.21e-46 147 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
B5Y963 6.39e-46 147 62 1 117 3 rpsM Small ribosomal subunit protein uS13 Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
C0ZIK5 6.7e-46 147 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B1VAC3 7.1e-46 147 61 0 116 3 rpsM Small ribosomal subunit protein uS13 Phytoplasma australiense
Q6MSP7 8.18e-46 147 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
P59754 8.83e-46 147 58 0 116 1 rpsM Small ribosomal subunit protein uS13 Enterococcus faecalis (strain ATCC 700802 / V583)
B2S0K3 9.46e-46 147 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Borrelia hermsii (strain HS1 / DAH)
B8D0T4 9.84e-46 147 60 0 116 3 rpsM Small ribosomal subunit protein uS13 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q28UT0 1.07e-45 146 63 1 117 3 rpsM Small ribosomal subunit protein uS13 Jannaschia sp. (strain CCS1)
B8E1F7 1.25e-45 146 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q5WLN7 1.34e-45 146 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Shouchella clausii (strain KSM-K16)
A8YXM8 1.51e-45 146 60 0 114 3 rpsM Small ribosomal subunit protein uS13 Lactobacillus helveticus (strain DPC 4571)
B0K5R8 1.52e-45 146 58 1 119 3 rpsM Small ribosomal subunit protein uS13 Thermoanaerobacter sp. (strain X514)
B0KCM5 1.52e-45 146 58 1 119 3 rpsM Small ribosomal subunit protein uS13 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q4A5I8 1.54e-45 146 59 0 116 3 rpsM Small ribosomal subunit protein uS13 Mycoplasmopsis synoviae (strain 53)
B5YDW7 1.79e-45 146 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B4U769 1.82e-45 146 62 1 115 3 rpsM Small ribosomal subunit protein uS13 Hydrogenobaculum sp. (strain Y04AAS1)
Q6F1W9 2.61e-45 145 58 0 116 3 rpsM Small ribosomal subunit protein uS13 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q1GK06 2.81e-45 145 63 1 117 3 rpsM Small ribosomal subunit protein uS13 Ruegeria sp. (strain TM1040)
O50632 3.01e-45 145 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P15757 3.33e-45 145 61 1 116 1 rpsM Small ribosomal subunit protein uS13 Geobacillus stearothermophilus
B5RPK4 3.33e-45 145 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Borrelia recurrentis (strain A1)
B5RM58 3.33e-45 145 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Borrelia duttonii (strain Ly)
Q5FM67 3.63e-45 145 59 0 114 3 rpsM Small ribosomal subunit protein uS13 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q6HPN4 4.93e-45 145 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H66 4.93e-45 145 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus cereus (strain ZK / E33L)
P62175 4.93e-45 145 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HJ73 4.93e-45 145 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus cereus (strain B4264)
C1ET64 4.93e-45 145 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus cereus (strain 03BB102)
B7JKE5 4.93e-45 145 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus cereus (strain AH820)
P62176 4.93e-45 145 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus anthracis
A0R8K4 4.93e-45 145 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus thuringiensis (strain Al Hakam)
C3LJW9 4.93e-45 145 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9T0 4.93e-45 145 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus anthracis (strain A0248)
Q9RDV8 6.66e-45 144 60 0 116 3 rpsM Small ribosomal subunit protein uS13 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
B5ZB64 6.99e-45 145 56 1 124 3 rpsM Small ribosomal subunit protein uS13 Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
B3E854 7.62e-45 144 63 1 117 3 rpsM Small ribosomal subunit protein uS13 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q1D751 7.8e-45 144 63 1 117 3 rpsM Small ribosomal subunit protein uS13 Myxococcus xanthus (strain DK1622)
B9IZL9 7.98e-45 144 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus cereus (strain Q1)
A7GK45 7.98e-45 144 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7HQW9 7.98e-45 144 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus cereus (strain AH187)
Q73F71 7.98e-45 144 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus cereus (strain ATCC 10987 / NRS 248)
B1KSJ9 8.04e-45 144 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Clostridium botulinum (strain Loch Maree / Type A3)
Q3A9U1 8.12e-45 144 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9RSJ9 9.11e-45 144 63 1 117 3 rpsM Small ribosomal subunit protein uS13 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
C5D3U2 1.02e-44 144 57 0 116 3 rpsM Small ribosomal subunit protein uS13 Geobacillus sp. (strain WCH70)
A7IPP8 1.06e-44 144 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q1WSB4 1.11e-44 144 61 0 112 3 rpsM Small ribosomal subunit protein uS13 Ligilactobacillus salivarius (strain UCC118)
Q6YQZ7 1.12e-44 144 60 0 116 3 rpsM Small ribosomal subunit protein uS13 Onion yellows phytoplasma (strain OY-M)
Q9PQN6 1.16e-44 144 56 1 124 3 rpsM Small ribosomal subunit protein uS13 Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AIP4 1.16e-44 144 56 1 124 3 rpsM Small ribosomal subunit protein uS13 Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
A9VPA2 1.25e-44 144 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus mycoides (strain KBAB4)
B3PMM3 1.7e-44 144 57 0 116 3 rpsM Small ribosomal subunit protein uS13 Metamycoplasma arthritidis (strain 158L3-1)
C1CXD7 1.86e-44 144 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A4VSH6 1.96e-44 143 62 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus suis (strain 05ZYH33)
A4VYR6 1.96e-44 143 62 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus suis (strain 98HAH33)
A0L5Z5 2.16e-44 143 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B2A4P7 2.21e-44 143 54 1 117 3 rpsM Small ribosomal subunit protein uS13 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B7IT44 2.33e-44 143 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Bacillus cereus (strain G9842)
Q749B0 2.36e-44 143 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q0SQH0 2.36e-44 143 57 0 116 3 rpsM Small ribosomal subunit protein uS13 Clostridium perfringens (strain SM101 / Type A)
Q8XHU8 2.36e-44 143 57 0 116 3 rpsM Small ribosomal subunit protein uS13 Clostridium perfringens (strain 13 / Type A)
Q0TMS2 2.36e-44 143 57 0 116 3 rpsM Small ribosomal subunit protein uS13 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A0LIL4 2.4e-44 143 62 1 117 3 rpsM Small ribosomal subunit protein uS13 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q035A7 2.44e-44 143 62 0 111 3 rpsM Small ribosomal subunit protein uS13 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAJ4 2.44e-44 143 62 0 111 3 rpsM Small ribosomal subunit protein uS13 Lacticaseibacillus casei (strain BL23)
C6E4N3 2.6e-44 143 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Geobacter sp. (strain M21)
B5EFS4 2.6e-44 143 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B9DSX4 2.6e-44 143 59 0 116 3 rpsM Small ribosomal subunit protein uS13 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
C1CIC1 2.94e-44 143 62 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pneumoniae (strain P1031)
C1CC30 2.94e-44 143 62 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pneumoniae (strain JJA)
P66393 2.94e-44 143 62 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS65 2.94e-44 143 62 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pneumoniae (strain CGSP14)
P66392 2.94e-44 143 62 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKQ3 2.94e-44 143 62 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8M2 2.94e-44 143 62 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAN6 2.94e-44 143 62 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pneumoniae (strain 70585)
Q04ML3 2.94e-44 143 62 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P66391 3.28e-44 143 61 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66390 3.28e-44 143 61 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3U6 3.28e-44 143 61 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q0BYD6 3.69e-44 142 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Hyphomonas neptunium (strain ATCC 15444)
A7GJ48 3.85e-44 142 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IGC8 3.85e-44 142 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Clostridium botulinum (strain Okra / Type B1)
C1FMS5 3.85e-44 142 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Clostridium botulinum (strain Kyoto / Type A2)
A5I7I0 3.85e-44 142 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KVM5 3.85e-44 142 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Clostridium botulinum (strain 657 / Type Ba4)
A7FZ47 3.85e-44 142 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Clostridium botulinum (strain ATCC 19397 / Type A)
Q5Z1L2 4.58e-44 142 58 1 118 3 rpsM Small ribosomal subunit protein uS13 Nocardia farcinica (strain IFM 10152)
Q03IH5 4.81e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M2D7 4.81e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXT5 4.81e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus thermophilus (strain CNRZ 1066)
Q5HAU3 4.89e-44 142 59 2 118 3 rpsM Small ribosomal subunit protein uS13 Ehrlichia ruminantium (strain Welgevonden)
Q5FFR9 4.89e-44 142 59 2 118 3 rpsM Small ribosomal subunit protein uS13 Ehrlichia ruminantium (strain Gardel)
A0PXX2 5.64e-44 142 57 1 117 3 rpsM Small ribosomal subunit protein uS13 Clostridium novyi (strain NT)
Q0ANS2 5.66e-44 142 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Maricaulis maris (strain MCS10)
Q1IX96 6.25e-44 142 61 1 117 3 rpsM Small ribosomal subunit protein uS13 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B2TIK1 6.38e-44 142 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYD6 6.38e-44 142 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Clostridium botulinum (strain Alaska E43 / Type E3)
C0ME29 6.39e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U524 6.39e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M7C5 6.39e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus equi subsp. equi (strain 4047)
C4KZM1 6.39e-44 142 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q8RE41 6.44e-44 142 59 0 118 3 rpsM Small ribosomal subunit protein uS13 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B5XJ60 6.75e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE69 6.75e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VS5 6.75e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC38 6.75e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J8Y9 6.75e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ37 6.75e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JNZ3 6.75e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE35 6.75e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66396 6.75e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEB1 6.75e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE68 6.75e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66394 6.75e-44 142 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus pyogenes serotype M1
B8EIT3 6.81e-44 142 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
C0Q9V0 7.12e-44 142 59 1 115 3 rpsM Small ribosomal subunit protein uS13 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B9E9L5 7.96e-44 142 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Macrococcus caseolyticus (strain JCSC5402)
A6X0E0 8.48e-44 142 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q3A6M3 1.01e-43 141 61 1 117 3 rpsM Small ribosomal subunit protein uS13 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A5N4S2 1.02e-43 141 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYD4 1.02e-43 141 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Clostridium kluyveri (strain NBRC 12016)
Q39XY2 1.04e-43 141 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8R7X9 1.15e-43 141 57 1 119 3 rpsM Small ribosomal subunit protein uS13 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A9NEF8 1.16e-43 141 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Acholeplasma laidlawii (strain PG-8A)
A1B050 1.39e-43 141 61 1 117 3 rpsM Small ribosomal subunit protein uS13 Paracoccus denitrificans (strain Pd 1222)
B9JDV0 1.42e-43 141 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q3YRN0 1.43e-43 141 60 1 115 3 rpsM Small ribosomal subunit protein uS13 Ehrlichia canis (strain Jake)
A8AZK1 1.52e-43 141 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q8DS35 1.64e-43 141 59 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B0UHU7 1.65e-43 141 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Methylobacterium sp. (strain 4-46)
A3CK88 1.68e-43 141 60 0 111 3 rpsM Small ribosomal subunit protein uS13 Streptococcus sanguinis (strain SK36)
Q211H0 1.71e-43 141 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Rhodopseudomonas palustris (strain BisB18)
Q1BD11 1.78e-43 141 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Mycobacterium sp. (strain MCS)
A1UBY2 1.78e-43 141 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Mycobacterium sp. (strain KMS)
A3PVL5 1.78e-43 141 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Mycobacterium sp. (strain JLS)
A4WVI6 1.87e-43 141 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q250K7 1.97e-43 141 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Desulfitobacterium hafniense (strain Y51)
B8G1Z1 1.97e-43 141 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q2NIX9 2.04e-43 141 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Aster yellows witches'-broom phytoplasma (strain AYWB)
Q2GH35 2.24e-43 140 60 1 115 3 rpsM Small ribosomal subunit protein uS13 Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q2G5A8 2.27e-43 140 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A5FZU3 2.31e-43 140 60 1 112 3 rpsM Small ribosomal subunit protein uS13 Acidiphilium cryptum (strain JF-5)
A1T517 2.31e-43 140 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A0M576 2.31e-43 140 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
B9M6F5 2.35e-43 140 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B9KLB3 2.48e-43 140 61 1 117 3 rpsM Small ribosomal subunit protein uS13 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J5Q0 2.48e-43 140 61 1 117 3 rpsM Small ribosomal subunit protein uS13 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGN3 2.48e-43 140 61 1 117 3 rpsM Small ribosomal subunit protein uS13 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A6LPT7 2.56e-43 140 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A6U881 2.62e-43 140 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Sinorhizobium medicae (strain WSM419)
Q98N35 2.8e-43 140 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B8IT33 2.83e-43 140 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A5FN18 3.01e-43 140 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q2GL38 3.25e-43 140 61 1 112 3 rpsM Small ribosomal subunit protein uS13 Anaplasma phagocytophilum (strain HZ)
A3DJJ8 3.55e-43 140 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A1QZT6 3.69e-43 140 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Borrelia turicatae (strain 91E135)
A6LLN8 4.06e-43 140 61 1 114 3 rpsM Small ribosomal subunit protein uS13 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q925X7 4.19e-43 140 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Rhizobium meliloti (strain 1021)
B1I1M4 4.72e-43 140 56 1 117 3 rpsM Small ribosomal subunit protein uS13 Desulforudis audaxviator (strain MP104C)
B3PWU3 4.78e-43 140 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Rhizobium etli (strain CIAT 652)
A5ELK5 4.89e-43 140 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q3SSU4 4.94e-43 140 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A1SNJ1 5.73e-43 140 55 1 117 3 rpsM Small ribosomal subunit protein uS13 Nocardioides sp. (strain ATCC BAA-499 / JS614)
P66383 5.9e-43 139 56 0 116 1 rpsM Small ribosomal subunit protein uS13 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB32 5.9e-43 139 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WH0 5.9e-43 139 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Listeria monocytogenes serotype 4b (strain F2365)
C1KZF7 5.9e-43 139 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Listeria monocytogenes serotype 4b (strain CLIP80459)
P66384 5.9e-43 139 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q2LQD2 6.02e-43 139 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Syntrophus aciditrophicus (strain SB)
Q8FS35 6.02e-43 139 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A7HBP2 6.42e-43 140 58 1 115 3 rpsM Small ribosomal subunit protein uS13 Anaeromyxobacter sp. (strain Fw109-5)
Q1QN08 6.43e-43 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A9H3J7 6.52e-43 139 62 1 112 3 rpsM Small ribosomal subunit protein uS13 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q2K9J4 6.57e-43 139 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A4TEI2 6.61e-43 139 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Mycolicibacterium gilvum (strain PYR-GCK)
Q03EE0 6.88e-43 139 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A1BJ10 7.52e-43 139 60 1 115 3 rpsM Small ribosomal subunit protein uS13 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q97EK3 7.64e-43 139 60 1 113 3 rpsM Small ribosomal subunit protein uS13 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B2IF93 7.83e-43 139 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q8UE39 8.18e-43 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Agrobacterium fabrum (strain C58 / ATCC 33970)
B0SSF5 8.48e-43 139 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SA23 8.48e-43 139 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A0ALU4 8.66e-43 139 56 0 116 3 rpsM Small ribosomal subunit protein uS13 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66382 8.93e-43 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Brucella suis biovar 1 (strain 1330)
B0CH09 8.93e-43 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VQY4 8.93e-43 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66381 8.93e-43 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJH8 8.93e-43 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5M7 8.93e-43 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CT0 8.93e-43 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Brucella abortus biovar 1 (strain 9-941)
Q2YRT8 8.93e-43 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Brucella abortus (strain 2308)
B2S657 8.93e-43 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Brucella abortus (strain S19)
A9IVZ8 9.33e-43 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Bartonella tribocorum (strain CIP 105476 / IBS 506)
P66389 9.45e-43 139 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain MW2)
A8Z333 9.45e-43 139 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G795 9.45e-43 139 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain MSSA476)
Q6GEK7 9.45e-43 139 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain MRSA252)
P66388 9.45e-43 139 55 0 116 1 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain N315)
P66387 9.45e-43 139 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ68 9.45e-43 139 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain Newman)
Q5HDY2 9.45e-43 139 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain COL)
Q2YYM0 9.45e-43 139 55 0 116 1 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV10 9.45e-43 139 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain JH9)
Q2FW30 9.45e-43 139 55 0 116 1 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER3 9.45e-43 139 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain USA300)
A6U3V1 9.45e-43 139 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain JH1)
A7X5C7 9.45e-43 139 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q02W49 9.55e-43 139 54 0 116 3 rpsM Small ribosomal subunit protein uS13 Lactococcus lactis subsp. cremoris (strain SK11)
A2RNM9 9.55e-43 139 54 0 116 1 rpsM Small ribosomal subunit protein uS13 Lactococcus lactis subsp. cremoris (strain MG1363)
P0A4A9 9.55e-43 139 54 0 116 3 rpsM Small ribosomal subunit protein uS13 Lactococcus lactis subsp. lactis (strain IL1403)
Q6KI31 1.06e-42 139 53 0 116 3 rpsM Small ribosomal subunit protein uS13 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
B8HCX6 1.08e-42 139 57 1 117 3 rpsM Small ribosomal subunit protein uS13 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A1USR6 1.09e-42 139 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A5GAU3 1.12e-42 139 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Geotalea uraniireducens (strain Rf4)
Q5NQ42 1.15e-42 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A4YSL4 1.21e-42 139 60 1 117 3 rpsM Small ribosomal subunit protein uS13 Bradyrhizobium sp. (strain ORS 278)
C3MB01 1.31e-42 139 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q5FU05 1.33e-42 139 61 1 112 3 rpsM Small ribosomal subunit protein uS13 Gluconobacter oxydans (strain 621H)
A0JZ51 1.33e-42 139 57 1 117 3 rpsM Small ribosomal subunit protein uS13 Arthrobacter sp. (strain FB24)
C1B038 1.35e-42 139 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Rhodococcus opacus (strain B4)
Q0S3F0 1.35e-42 139 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Rhodococcus jostii (strain RHA1)
Q0AUK6 1.46e-42 139 58 1 115 3 rpsM Small ribosomal subunit protein uS13 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q11HS4 1.49e-42 139 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Chelativorans sp. (strain BNC1)
B9DM53 1.6e-42 138 55 0 116 3 rpsM Small ribosomal subunit protein uS13 Staphylococcus carnosus (strain TM300)
B5ZZ55 1.88e-42 138 59 1 117 3 rpsM Small ribosomal subunit protein uS13 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q5PA79 1.9e-42 138 59 1 112 3 rpsM Small ribosomal subunit protein uS13 Anaplasma marginale (strain St. Maries)
B9KJ49 1.9e-42 138 59 1 112 3 rpsM Small ribosomal subunit protein uS13 Anaplasma marginale (strain Florida)
B9JVQ9 1.94e-42 138 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
P80377 2.03e-42 138 58 1 117 1 rpsM Small ribosomal subunit protein uS13 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P62655 2.03e-42 138 58 1 117 1 rpsM Small ribosomal subunit protein uS13 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B7J265 2.13e-42 138 55 1 117 3 rpsM Small ribosomal subunit protein uS13 Borreliella burgdorferi (strain ZS7)
O51453 2.13e-42 138 55 1 117 1 rpsM Small ribosomal subunit protein uS13 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q0BUM8 2.2e-42 138 60 1 112 3 rpsM Small ribosomal subunit protein uS13 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q661C0 2.3e-42 138 56 1 117 3 rpsM Small ribosomal subunit protein uS13 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
C4LKZ4 2.31e-42 138 56 1 117 3 rpsM Small ribosomal subunit protein uS13 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
B0TC82 2.36e-42 138 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B6IRS8 2.36e-42 138 57 1 117 3 rpsM Small ribosomal subunit protein uS13 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q8KAJ5 2.43e-42 138 60 1 115 3 rpsM Small ribosomal subunit protein uS13 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q0SN07 2.45e-42 138 56 1 117 3 rpsM Small ribosomal subunit protein uS13 Borreliella afzelii (strain PKo)
Q890Q7 2.55e-42 138 56 1 117 3 rpsM Small ribosomal subunit protein uS13 Clostridium tetani (strain Massachusetts / E88)
A9W4R8 2.55e-42 138 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Methylorubrum extorquens (strain PA1)
B7L0S8 2.55e-42 138 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q9X7A1 3.06e-42 138 58 1 117 3 rpsM Small ribosomal subunit protein uS13 Mycobacterium leprae (strain TN)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16255
Feature type CDS
Gene rpsM
Product 30S ribosomal protein S13
Location 3593207 - 3593563 (strand: 1)
Length 357 (nucleotides) / 118 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2410
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00416 Ribosomal protein S13/S18

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0099 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S13

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02952 small subunit ribosomal protein S13 Ribosome -

Protein Sequence

MARIAGINIPDHKHTVIALTSIYGIGKTRSQAICEATGIAENVKISELSEEQIDKLRDEVAKYVVEGDLRREVTLSIKRLMDLGTYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK

Flanking regions ( +/- flanking 50bp)

AAACGGGCTTTTCAGAATAGTACTGTATAAAGTTAATTTAGGAGTGCATAGTGGCCCGTATAGCAGGCATTAACATTCCTGATCATAAACATACCGTAATCGCTTTAACATCGATTTACGGCATTGGTAAAACTCGTTCACAGGCTATCTGTGAAGCAACGGGTATTGCTGAAAATGTTAAGATCAGTGAGCTGTCTGAAGAGCAAATCGACAAGCTGCGTGACGAAGTTGCCAAATACGTTGTAGAAGGTGATCTACGTCGTGAAGTTACCCTGAGCATCAAACGTCTGATGGATCTTGGTACTTACCGTGGTTTACGTCATCGTCGTGGTCTACCAGTTCGCGGTCAGCGTACTAAGACTAACGCACGTACCCGTAAGGGTCCGCGTAAGCCGATCAAGAAATAATCGGGGTATTTGAACAATGGCAAAAGCACCTATTCGTGCACGTAAGCGTG