Homologs in group_2427

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19220 FBDBKF_19220 95.5 Morganella morganii S1 rplV 50S ribosomal protein L22
EHELCC_18965 EHELCC_18965 95.5 Morganella morganii S2 rplV 50S ribosomal protein L22
NLDBIP_18980 NLDBIP_18980 95.5 Morganella morganii S4 rplV 50S ribosomal protein L22
LHKJJB_18835 LHKJJB_18835 95.5 Morganella morganii S3 rplV 50S ribosomal protein L22
HKOGLL_18570 HKOGLL_18570 95.5 Morganella morganii S5 rplV 50S ribosomal protein L22
F4V73_RS18945 F4V73_RS18945 94.5 Morganella psychrotolerans rplV 50S ribosomal protein L22

Distribution of the homologs in the orthogroup group_2427

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2427

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1I9 9.92e-75 219 100 0 110 3 rplV Large ribosomal subunit protein uL22 Proteus mirabilis (strain HI4320)
B1JIW6 6.36e-73 214 98 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664S6 6.36e-73 214 98 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGZ7 6.36e-73 214 98 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pestis (strain Pestoides F)
Q1CCU9 6.36e-73 214 98 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R901 6.36e-73 214 98 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJA7 6.36e-73 214 98 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pestis
B2K5M5 6.36e-73 214 98 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2V2 6.36e-73 214 98 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNN0 6.36e-73 214 98 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JS31 4.39e-72 213 97 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GKJ2 4.39e-72 213 97 0 110 3 rplV Large ribosomal subunit protein uL22 Serratia proteamaculans (strain 568)
Q7MYF6 6.03e-72 212 96 0 110 3 rplV Large ribosomal subunit protein uL22 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2NQM7 7.27e-72 212 97 0 110 3 rplV Large ribosomal subunit protein uL22 Sodalis glossinidius (strain morsitans)
C6DG69 1.26e-71 211 97 0 110 3 rplV Large ribosomal subunit protein uL22 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZX5 1.26e-71 211 97 0 110 3 rplV Large ribosomal subunit protein uL22 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TEW7 3.35e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XN99 3.35e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Klebsiella pneumoniae (strain 342)
Q3YWU4 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Shigella sonnei (strain Ss046)
Q32B36 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VW1 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Shigella boydii serotype 4 (strain Sb227)
B2U2T3 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P61179 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P61178 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella typhi
B4TXD7 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella schwarzengrund (strain CVM19633)
B5BGY1 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella paratyphi A (strain AKU_12601)
C0Q0B1 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella paratyphi C (strain RKS4594)
A9MSZ3 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIV7 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUT5 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella newport (strain SL254)
B4TKL0 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella heidelberg (strain SL476)
B5RH20 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R286 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella enteritidis PT4 (strain P125109)
B5FJK9 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella dublin (strain CT_02021853)
B5F8E7 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella agona (strain SL483)
B7LRT1 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R610 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain UTI89 / UPEC)
B1LHC9 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain SMS-3-5 / SECEC)
B6I229 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain SE11)
B7NDT6 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P61175 7.23e-70 207 95 0 110 1 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain K12)
B1IPY4 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P61176 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCE6 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGK3 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O1:K1 / APEC
A8A5C0 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O9:H4 (strain HS)
B1X6G6 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain K12 / DH10B)
C4ZUH0 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1M9 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O8 (strain IAI1)
B7N199 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O81 (strain ED1a)
B7NLN4 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTN6 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P61177 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O157:H7
B7L4K4 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain 55989 / EAEC)
B7MCT0 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK39 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSK4 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O139:H28 (strain E24377A / ETEC)
A7MPI4 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Cronobacter sakazakii (strain ATCC BAA-894)
A8AQL2 7.23e-70 207 95 0 110 3 rplV Large ribosomal subunit protein uL22 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4WFC3 9.41e-70 206 94 0 110 3 rplV Large ribosomal subunit protein uL22 Enterobacter sp. (strain 638)
B2VK59 1.19e-69 206 94 0 110 3 rplV Large ribosomal subunit protein uL22 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A9MN53 1.32e-69 206 94 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P55838 7.57e-69 204 91 0 110 3 rplV Large ribosomal subunit protein uL22 Aggregatibacter actinomycetemcomitans
Q83PY5 7.66e-69 204 94 0 110 3 rplV Large ribosomal subunit protein uL22 Shigella flexneri
Q0SZY7 7.66e-69 204 94 0 110 3 rplV Large ribosomal subunit protein uL22 Shigella flexneri serotype 5b (strain 8401)
P44360 1.56e-68 203 91 0 110 3 rplV Large ribosomal subunit protein uL22 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHT5 1.56e-68 203 91 0 110 3 rplV Large ribosomal subunit protein uL22 Haemophilus influenzae (strain PittGG)
A5UDU2 1.56e-68 203 91 0 110 3 rplV Large ribosomal subunit protein uL22 Haemophilus influenzae (strain PittEE)
Q4QMB7 1.56e-68 203 91 0 110 3 rplV Large ribosomal subunit protein uL22 Haemophilus influenzae (strain 86-028NP)
Q0I158 2.2e-68 203 90 0 110 3 rplV Large ribosomal subunit protein uL22 Histophilus somni (strain 129Pt)
B0BST6 2.2e-68 203 90 0 110 3 rplV Large ribosomal subunit protein uL22 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ16 2.2e-68 203 90 0 110 3 rplV Large ribosomal subunit protein uL22 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N363 2.2e-68 203 90 0 110 3 rplV Large ribosomal subunit protein uL22 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VLJ3 4.68e-68 202 91 0 110 3 rplV Large ribosomal subunit protein uL22 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7VKD6 5.11e-68 202 90 0 110 3 rplV Large ribosomal subunit protein uL22 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8F760 9.05e-68 201 90 0 110 3 rplV Large ribosomal subunit protein uL22 Glaesserella parasuis serovar 5 (strain SH0165)
B0UX18 1.11e-67 201 90 0 110 3 rplV Large ribosomal subunit protein uL22 Histophilus somni (strain 2336)
Q9CL36 1.95e-67 201 90 0 110 3 rplV Large ribosomal subunit protein uL22 Pasteurella multocida (strain Pm70)
Q65QW0 2.23e-67 201 90 0 110 3 rplV Large ribosomal subunit protein uL22 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q1LTD3 1.18e-62 189 85 0 110 3 rplV Large ribosomal subunit protein uL22 Baumannia cicadellinicola subsp. Homalodisca coagulata
C4K7B3 3.11e-61 185 84 0 109 3 rplV Large ribosomal subunit protein uL22 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B8D844 4.08e-61 185 81 0 110 3 rplV Large ribosomal subunit protein uL22 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57586 4.08e-61 185 81 0 110 3 rplV Large ribosomal subunit protein uL22 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9U2 4.08e-61 185 81 0 110 3 rplV Large ribosomal subunit protein uL22 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q87T08 7.45e-61 184 83 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MPI3 2.46e-60 182 83 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio vulnificus (strain YJ016)
Q8DE44 2.46e-60 182 83 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio vulnificus (strain CMCP6)
A7MWI8 2.46e-60 182 83 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio campbellii (strain ATCC BAA-1116)
Q6LVB1 2.75e-59 180 80 0 110 3 rplV Large ribosomal subunit protein uL22 Photobacterium profundum (strain SS9)
C3LRQ3 3.36e-59 180 82 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNY9 3.36e-59 180 82 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F544 3.36e-59 180 82 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B5FG14 8.44e-58 176 80 0 110 3 rplV Large ribosomal subunit protein uL22 Aliivibrio fischeri (strain MJ11)
Q5E8B0 8.44e-58 176 80 0 110 3 rplV Large ribosomal subunit protein uL22 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8K955 2.19e-57 175 76 0 110 3 rplV Large ribosomal subunit protein uL22 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A1S223 3.01e-57 175 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B6EPT0 3.4e-57 175 79 0 110 3 rplV Large ribosomal subunit protein uL22 Aliivibrio salmonicida (strain LFI1238)
A3Q987 5.82e-57 174 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1REB9 1.08e-56 174 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella sp. (strain W3-18-1)
Q0I0A0 1.08e-56 174 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella sp. (strain MR-7)
Q0HNT2 1.08e-56 174 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella sp. (strain MR-4)
A0KRM9 1.08e-56 174 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella sp. (strain ANA-3)
A4YBX8 1.08e-56 174 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EK63 1.08e-56 174 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q089P9 1.08e-56 174 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella frigidimarina (strain NCIMB 400)
A9KWA7 1.08e-56 174 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella baltica (strain OS195)
A6WHT3 1.08e-56 174 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella baltica (strain OS185)
A3DA67 1.08e-56 174 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBK0 1.08e-56 174 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella baltica (strain OS223)
Q12SV4 3.48e-56 172 77 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q15YN4 6.23e-55 169 75 0 109 3 rplV Large ribosomal subunit protein uL22 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
P59558 1.74e-54 168 74 0 109 3 rplV Large ribosomal subunit protein uL22 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B1KMX8 1.79e-54 168 75 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella woodyi (strain ATCC 51908 / MS32)
A8G1E3 1.79e-54 168 75 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella sediminis (strain HAW-EB3)
B8CND8 1.79e-54 168 75 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8GYY1 1.79e-54 168 75 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TM07 1.79e-54 168 75 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella halifaxensis (strain HAW-EB4)
B4S096 2.96e-54 167 76 0 109 3 rplV Large ribosomal subunit protein uL22 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A0KF26 3.28e-54 167 77 0 109 3 rplV Large ribosomal subunit protein uL22 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q487Z8 5.12e-54 167 75 0 109 3 rplV Large ribosomal subunit protein uL22 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A4ST01 1.22e-53 166 77 0 109 3 rplV Large ribosomal subunit protein uL22 Aeromonas salmonicida (strain A449)
Q5QXY2 1.69e-53 166 75 0 109 3 rplV Large ribosomal subunit protein uL22 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A1T0D7 1.36e-52 163 72 0 110 3 rplV Large ribosomal subunit protein uL22 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q493K3 1.87e-52 163 71 0 109 3 rplV Large ribosomal subunit protein uL22 Blochmanniella pennsylvanica (strain BPEN)
Q3IF20 2.09e-52 162 74 0 109 3 rplV Large ribosomal subunit protein uL22 Pseudoalteromonas translucida (strain TAC 125)
Q7VQE3 1.09e-51 161 71 0 109 3 rplV Large ribosomal subunit protein uL22 Blochmanniella floridana
Q8D207 2.77e-51 160 67 0 110 3 rplV Large ribosomal subunit protein uL22 Wigglesworthia glossinidia brevipalpis
Q605B7 4.12e-51 159 70 0 109 3 rplV Large ribosomal subunit protein uL22 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1WVB7 1.91e-49 155 70 0 109 3 rplV Large ribosomal subunit protein uL22 Halorhodospira halophila (strain DSM 244 / SL1)
Q21M52 1.75e-48 153 70 0 110 3 rplV Large ribosomal subunit protein uL22 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q4ZMP9 8.97e-48 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas syringae pv. syringae (strain B728a)
Q889W6 8.97e-48 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48D41 8.97e-48 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1JDV9 1.02e-47 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas putida (strain W619)
Q88QN0 1.02e-47 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK72 1.02e-47 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas putida (strain GB-1)
Q3K5Z3 1.02e-47 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas fluorescens (strain Pf0-1)
A5VXQ2 1.02e-47 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4XZ85 1.02e-47 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas mendocina (strain ymp)
C3K2X1 1.02e-47 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas fluorescens (strain SBW25)
Q4K538 1.02e-47 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1IFW1 1.02e-47 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas entomophila (strain L48)
Q9HWE0 1.02e-47 151 68 0 110 1 rplV Large ribosomal subunit protein uL22 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T75 1.02e-47 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V649 1.02e-47 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas aeruginosa (strain LESB58)
A6UZJ3 1.02e-47 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas aeruginosa (strain PA7)
A4VHN5 3.38e-47 149 68 0 110 3 rplV Large ribosomal subunit protein uL22 Stutzerimonas stutzeri (strain A1501)
Q0ABH0 5.52e-47 149 67 0 110 3 rplV Large ribosomal subunit protein uL22 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
C1DAS2 6.68e-47 149 67 0 109 3 rplV Large ribosomal subunit protein uL22 Laribacter hongkongensis (strain HLHK9)
Q2S917 7.44e-47 149 67 0 109 3 rplV Large ribosomal subunit protein uL22 Hahella chejuensis (strain KCTC 2396)
C5BQ66 1.09e-46 148 68 0 110 3 rplV Large ribosomal subunit protein uL22 Teredinibacter turnerae (strain ATCC 39867 / T7901)
B0V6X3 1.97e-46 147 71 0 107 3 rplV Large ribosomal subunit protein uL22 Acinetobacter baumannii (strain AYE)
B0VQS3 1.97e-46 147 71 0 107 3 rplV Large ribosomal subunit protein uL22 Acinetobacter baumannii (strain SDF)
B2HZL7 1.97e-46 147 71 0 107 3 rplV Large ribosomal subunit protein uL22 Acinetobacter baumannii (strain ACICU)
Q6F7R7 2.57e-46 147 71 0 107 3 rplV Large ribosomal subunit protein uL22 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B8GV53 3.3e-46 147 66 0 109 3 rplV Large ribosomal subunit protein uL22 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
B3PK42 2.38e-45 145 68 0 110 3 rplV Large ribosomal subunit protein uL22 Cellvibrio japonicus (strain Ueda107)
A1KRH8 6.97e-45 144 66 0 109 3 rplV Large ribosomal subunit protein uL22 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7DDT5 6.97e-45 144 66 0 109 1 rplV Large ribosomal subunit protein uL22 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JRD8 6.97e-45 144 66 0 109 3 rplV Large ribosomal subunit protein uL22 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3W1 6.97e-45 144 66 0 109 3 rplV Large ribosomal subunit protein uL22 Neisseria meningitidis serogroup C (strain 053442)
B4RQY3 6.97e-45 144 66 0 109 3 rplV Large ribosomal subunit protein uL22 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5T2 6.97e-45 144 66 0 109 3 rplV Large ribosomal subunit protein uL22 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1AVK5 9.04e-45 143 68 0 107 3 rplV Large ribosomal subunit protein uL22 Ruthia magnifica subsp. Calyptogena magnifica
A1TYK2 1.34e-44 143 64 0 110 3 rplV Large ribosomal subunit protein uL22 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A6W387 1.51e-44 143 68 0 108 3 rplV Large ribosomal subunit protein uL22 Marinomonas sp. (strain MWYL1)
A9IIZ3 3.61e-44 142 68 0 107 3 rplV Large ribosomal subunit protein uL22 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A4IZS9 3.75e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHW3 3.75e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNS2 3.75e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4I8 3.75e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. novicida (strain U112)
B2SDY0 3.75e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5G5 3.75e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. holarctica (strain LVS)
A7N9T1 3.75e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14JB5 3.75e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. tularensis (strain FSC 198)
A5CXK9 6.16e-44 141 67 0 104 3 rplV Large ribosomal subunit protein uL22 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q46WE9 2.22e-43 140 65 0 109 3 rplV Large ribosomal subunit protein uL22 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K624 2.22e-43 140 65 0 109 3 rplV Large ribosomal subunit protein uL22 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1QDI1 2.65e-43 140 65 0 109 3 rplV Large ribosomal subunit protein uL22 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FUF1 2.65e-43 140 65 0 109 3 rplV Large ribosomal subunit protein uL22 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A5WCJ5 3.89e-43 139 66 0 109 3 rplV Large ribosomal subunit protein uL22 Psychrobacter sp. (strain PRwf-1)
O85387 5.15e-43 139 64 0 109 3 rplV Large ribosomal subunit protein uL22 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAM9 5.15e-43 139 64 0 109 3 rplV Large ribosomal subunit protein uL22 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD26 5.15e-43 139 64 0 109 3 rplV Large ribosomal subunit protein uL22 Coxiella burnetii (strain Dugway 5J108-111)
B6J258 5.15e-43 139 64 0 109 3 rplV Large ribosomal subunit protein uL22 Coxiella burnetii (strain CbuG_Q212)
Q7VTC8 6.37e-43 139 68 0 107 3 rplV Large ribosomal subunit protein uL22 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2F1 6.37e-43 139 68 0 107 3 rplV Large ribosomal subunit protein uL22 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRC0 6.37e-43 139 68 0 107 3 rplV Large ribosomal subunit protein uL22 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2L2E3 6.37e-43 139 68 0 107 3 rplV Large ribosomal subunit protein uL22 Bordetella avium (strain 197N)
B0U0Y4 6.69e-43 139 63 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B6J5D7 7.4e-43 139 64 0 109 3 rplV Large ribosomal subunit protein uL22 Coxiella burnetii (strain CbuK_Q154)
B2UEL4 8.1e-43 138 63 0 109 3 rplV Large ribosomal subunit protein uL22 Ralstonia pickettii (strain 12J)
B3R7R8 9.04e-43 138 64 0 109 3 rplV Large ribosomal subunit protein uL22 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B1Y8I2 1.51e-42 138 64 0 109 3 rplV Large ribosomal subunit protein uL22 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q1LI42 1.86e-42 137 64 0 109 3 rplV Large ribosomal subunit protein uL22 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q31IX7 2.64e-42 137 62 0 110 3 rplV Large ribosomal subunit protein uL22 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q7CLU6 3.37e-42 137 66 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU77 3.37e-42 137 66 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas campestris pv. campestris (strain B100)
Q4URE4 3.37e-42 137 66 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas campestris pv. campestris (strain 8004)
Q8NKY0 3.37e-42 137 66 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas axonopodis pv. citri (strain 306)
Q3BWX8 3.66e-42 137 66 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B2SQR5 5.99e-42 136 65 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q5GWT9 6.5e-42 136 65 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZZ0 6.5e-42 136 65 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A1W2R2 7.64e-42 136 66 0 108 3 rplV Large ribosomal subunit protein uL22 Acidovorax sp. (strain JS42)
B9MB78 7.64e-42 136 66 0 108 3 rplV Large ribosomal subunit protein uL22 Acidovorax ebreus (strain TPSY)
B4SKW8 1.11e-41 135 64 0 108 3 rplV Large ribosomal subunit protein uL22 Stenotrophomonas maltophilia (strain R551-3)
B2FQ50 1.18e-41 135 64 0 108 3 rplV Large ribosomal subunit protein uL22 Stenotrophomonas maltophilia (strain K279a)
A9BPS3 1.21e-41 135 64 0 108 3 rplV Large ribosomal subunit protein uL22 Delftia acidovorans (strain DSM 14801 / SPH-1)
B2JI61 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A4JAP5 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2SU32 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q16 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia pseudomallei (strain K96243)
A3NEH4 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia pseudomallei (strain 668)
Q3JMR8 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia pseudomallei (strain 1710b)
A3P0A8 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia pseudomallei (strain 1106a)
Q1BRV3 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia orbicola (strain AU 1054)
B1JU27 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia orbicola (strain MC0-3)
A1V898 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia mallei (strain SAVP1)
Q62GL0 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia mallei (strain ATCC 23344)
A2S7I1 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia mallei (strain NCTC 10229)
A3MRV9 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia mallei (strain NCTC 10247)
A9ADJ8 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39KG2 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ41 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5C5 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3N0 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia cenocepacia (strain HI2424)
B1YRD5 2.14e-41 135 63 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia ambifaria (strain MC40-6)
Q13TH5 2.61e-41 135 62 0 109 3 rplV Large ribosomal subunit protein uL22 Paraburkholderia xenovorans (strain LB400)
A1TJ12 2.72e-41 135 64 0 108 3 rplV Large ribosomal subunit protein uL22 Paracidovorax citrulli (strain AAC00-1)
Q12GW6 2.82e-41 134 63 0 109 3 rplV Large ribosomal subunit protein uL22 Polaromonas sp. (strain JS666 / ATCC BAA-500)
B2T746 2.91e-41 134 62 0 109 3 rplV Large ribosomal subunit protein uL22 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A1KB22 5.1e-41 134 62 0 109 3 rplV Large ribosomal subunit protein uL22 Azoarcus sp. (strain BH72)
A1VIQ5 8.25e-41 133 62 0 109 3 rplV Large ribosomal subunit protein uL22 Polaromonas naphthalenivorans (strain CJ2)
Q1H4N2 9.41e-41 133 63 0 109 3 rplV Large ribosomal subunit protein uL22 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A6T3J9 2.21e-40 132 62 0 109 3 rplV Large ribosomal subunit protein uL22 Janthinobacterium sp. (strain Marseille)
C5CP48 2.69e-40 132 62 0 108 3 rplV Large ribosomal subunit protein uL22 Variovorax paradoxus (strain S110)
Q47J98 2.75e-40 132 62 0 109 3 rplV Large ribosomal subunit protein uL22 Dechloromonas aromatica (strain RCB)
Q3SLP4 2.88e-40 132 63 0 109 3 rplV Large ribosomal subunit protein uL22 Thiobacillus denitrificans (strain ATCC 25259)
A4SUW6 3.21e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q8XV17 3.25e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q21RW3 5.37e-40 131 62 0 109 3 rplV Large ribosomal subunit protein uL22 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A4J116 5.93e-40 131 61 0 110 3 rplV Large ribosomal subunit protein uL22 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q5WZK7 9.14e-40 131 63 0 109 3 rplV Large ribosomal subunit protein uL22 Legionella pneumophila (strain Lens)
A5IHQ9 9.14e-40 131 63 0 109 3 rplV Large ribosomal subunit protein uL22 Legionella pneumophila (strain Corby)
Q5X854 9.14e-40 131 63 0 109 3 rplV Large ribosomal subunit protein uL22 Legionella pneumophila (strain Paris)
Q5ZYN8 9.73e-40 130 63 0 109 3 rplV Large ribosomal subunit protein uL22 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
B1XSQ6 1.27e-39 130 60 0 109 3 rplV Large ribosomal subunit protein uL22 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q5P327 1.35e-39 130 62 0 109 3 rplV Large ribosomal subunit protein uL22 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A5EX77 3.6e-39 129 62 0 110 3 rplV Large ribosomal subunit protein uL22 Dichelobacter nodosus (strain VCS1703A)
Q1R0H0 3.98e-39 129 67 0 110 3 rplV Large ribosomal subunit protein uL22 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2YAZ2 4.14e-39 129 59 0 110 3 rplV Large ribosomal subunit protein uL22 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q7NQF7 4.26e-39 129 59 0 109 3 rplV Large ribosomal subunit protein uL22 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q82X83 5.4e-39 129 55 0 110 3 rplV Large ribosomal subunit protein uL22 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1WHD0 1.26e-38 128 62 0 108 3 rplV Large ribosomal subunit protein uL22 Verminephrobacter eiseniae (strain EF01-2)
Q81J37 1.29e-38 128 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IZJ9 1.29e-38 128 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain Q1)
B7HQU9 1.29e-38 128 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain AH187)
B7HJ53 1.29e-38 128 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain B4264)
B7IT24 1.29e-38 128 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain G9842)
Q73F91 1.29e-38 128 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain ATCC 10987 / NRS 248)
B0K5P8 1.29e-38 128 60 0 110 3 rplV Large ribosomal subunit protein uL22 Thermoanaerobacter sp. (strain X514)
B0KCK5 1.29e-38 128 60 0 110 3 rplV Large ribosomal subunit protein uL22 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q0VSJ8 1.31e-38 128 69 0 108 3 rplV Large ribosomal subunit protein uL22 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A9VP82 1.85e-38 127 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus mycoides (strain KBAB4)
A4G9T3 2.15e-38 127 60 0 109 3 rplV Large ribosomal subunit protein uL22 Herminiimonas arsenicoxydans
A7GK25 2.32e-38 127 58 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q0AIJ0 2.5e-38 127 55 0 110 3 rplV Large ribosomal subunit protein uL22 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q6HPQ3 2.54e-38 127 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H85 2.54e-38 127 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain ZK / E33L)
C1ET44 2.54e-38 127 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain 03BB102)
B7JKC4 2.54e-38 127 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain AH820)
Q81VS5 2.54e-38 127 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus anthracis
A0R8I5 2.54e-38 127 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus thuringiensis (strain Al Hakam)
C3LJ87 2.54e-38 127 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9R0 2.54e-38 127 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus anthracis (strain A0248)
Q6MJ19 4.72e-38 126 55 0 110 3 rplV Large ribosomal subunit protein uL22 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A2SLF2 5.17e-38 126 62 0 109 3 rplV Large ribosomal subunit protein uL22 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B0U5K4 2.94e-37 124 60 0 107 3 rplV Large ribosomal subunit protein uL22 Xylella fastidiosa (strain M12)
C0ZII5 3.32e-37 124 57 0 110 3 rplV Large ribosomal subunit protein uL22 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B5ELY4 4.44e-37 124 57 0 109 3 rplV Large ribosomal subunit protein uL22 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J472 4.44e-37 124 57 0 109 3 rplV Large ribosomal subunit protein uL22 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q250M7 6.25e-37 124 62 0 106 3 rplV Large ribosomal subunit protein uL22 Desulfitobacterium hafniense (strain Y51)
Q87E77 1.6e-36 122 59 0 107 3 rplV Large ribosomal subunit protein uL22 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8H4 1.6e-36 122 59 0 107 3 rplV Large ribosomal subunit protein uL22 Xylella fastidiosa (strain M23)
B8G1X1 1.69e-36 122 62 0 106 3 rplV Large ribosomal subunit protein uL22 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B1HMX5 2.3e-36 122 58 0 106 3 rplV Large ribosomal subunit protein uL22 Lysinibacillus sphaericus (strain C3-41)
Q8R7V9 2.91e-36 122 57 0 110 3 rplV Large ribosomal subunit protein uL22 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9PE71 3.59e-36 122 59 0 107 3 rplV Large ribosomal subunit protein uL22 Xylella fastidiosa (strain 9a5c)
Q0AUI5 4.3e-36 122 58 0 110 3 rplV Large ribosomal subunit protein uL22 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A5D5J5 6.11e-36 121 57 0 110 3 rplV Large ribosomal subunit protein uL22 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A0PXV1 7.48e-36 121 52 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridium novyi (strain NT)
A0L5X8 8.96e-36 121 55 0 107 3 rplV Large ribosomal subunit protein uL22 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A9B417 1.07e-35 120 57 0 109 3 rplV Large ribosomal subunit protein uL22 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q8RIG0 1.68e-35 120 58 0 109 3 rplV Large ribosomal subunit protein uL22 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B1YGV5 3.51e-35 119 53 0 110 3 rplV Large ribosomal subunit protein uL22 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q057A9 5.25e-35 119 62 0 109 3 rplV Large ribosomal subunit protein uL22 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A0ALW3 6.24e-35 119 56 0 105 3 rplV Large ribosomal subunit protein uL22 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q927L2 6.24e-35 119 56 0 105 1 rplV Large ribosomal subunit protein uL22 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB13 6.24e-35 119 56 0 105 3 rplV Large ribosomal subunit protein uL22 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WF1 6.24e-35 119 56 0 105 3 rplV Large ribosomal subunit protein uL22 Listeria monocytogenes serotype 4b (strain F2365)
C1KZH5 6.24e-35 119 56 0 105 3 rplV Large ribosomal subunit protein uL22 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q7ANU3 6.24e-35 119 56 0 105 3 rplV Large ribosomal subunit protein uL22 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A7Z0P3 9.52e-35 118 52 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P42060 9.52e-35 118 52 0 110 1 rplV Large ribosomal subunit protein uL22 Bacillus subtilis (strain 168)
B2UMT4 1.04e-34 118 53 0 110 3 rplV Large ribosomal subunit protein uL22 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q6AP66 1.07e-34 118 55 0 109 3 rplV Large ribosomal subunit protein uL22 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A8MLE5 1.07e-34 118 52 0 110 3 rplV Large ribosomal subunit protein uL22 Alkaliphilus oremlandii (strain OhILAs)
C6C190 1.2e-34 118 57 0 109 3 rplV Large ribosomal subunit protein uL22 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q839F9 1.43e-34 118 54 0 106 1 rplV Large ribosomal subunit protein uL22 Enterococcus faecalis (strain ATCC 700802 / V583)
A4IJJ4 1.76e-34 117 52 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacillus thermodenitrificans (strain NG80-2)
Q03EC1 1.99e-34 117 54 0 106 3 rplV Large ribosomal subunit protein uL22 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q8ETX7 2.07e-34 117 53 0 110 3 rplV Large ribosomal subunit protein uL22 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P48286 2.28e-34 117 56 0 110 1 rplV Large ribosomal subunit protein uL22 Thermus thermophilus
Q5SHP3 2.28e-34 117 56 0 110 1 rplV Large ribosomal subunit protein uL22 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72I09 2.28e-34 117 56 0 110 1 rplV Large ribosomal subunit protein uL22 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
C4KZP1 2.69e-34 117 57 0 100 3 rplV Large ribosomal subunit protein uL22 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B1LBN5 2.7e-34 119 51 0 110 3 rplV Large ribosomal subunit protein uL22 Thermotoga sp. (strain RQ2)
B7GJ72 2.72e-34 117 52 0 110 3 rplV Large ribosomal subunit protein uL22 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A8F990 3.9e-34 117 53 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus pumilus (strain SAFR-032)
Q3J8R9 3.99e-34 116 62 0 109 3 rplV Large ribosomal subunit protein uL22 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B9E9J6 4.15e-34 117 53 0 110 3 rplV Large ribosomal subunit protein uL22 Macrococcus caseolyticus (strain JCSC5402)
A3DJH7 4.18e-34 117 54 0 106 3 rplV Large ribosomal subunit protein uL22 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A5IM88 4.6e-34 118 50 0 110 3 rplV Large ribosomal subunit protein uL22 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q5L418 5.6e-34 116 51 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacillus kaustophilus (strain HTA426)
B1I1J3 7.44e-34 116 55 0 109 3 rplV Large ribosomal subunit protein uL22 Desulforudis audaxviator (strain MP104C)
B0TC61 8.78e-34 117 57 0 105 3 rplV Large ribosomal subunit protein uL22 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q65PA2 9.23e-34 115 53 0 106 3 rplV Large ribosomal subunit protein uL22 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q6XYY1 1.06e-33 115 56 0 109 3 rplV Large ribosomal subunit protein uL22 Spiroplasma kunkelii
B8G6S0 1.12e-33 115 53 0 110 3 rplV Large ribosomal subunit protein uL22 Chloroflexus aggregans (strain MD-66 / DSM 9485)
P38511 1.28e-33 117 50 0 110 3 rplV Large ribosomal subunit protein uL22 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B9DM42 1.76e-33 115 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus carnosus (strain TM300)
A0LIJ5 2.32e-33 114 50 0 110 3 rplV Large ribosomal subunit protein uL22 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
C5D3S2 2.74e-33 114 51 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacillus sp. (strain WCH70)
Q7A079 2.85e-33 114 53 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain MW2)
Q6G776 2.85e-33 114 53 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain MSSA476)
Q6GEI8 2.85e-33 114 53 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain MRSA252)
Q7A460 2.85e-33 114 53 0 109 1 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain N315)
Q99S26 2.85e-33 114 53 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ87 2.85e-33 114 53 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain Newman)
Q5HDW3 2.85e-33 114 53 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain COL)
Q2YYQ1 2.85e-33 114 53 0 109 1 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV29 2.85e-33 114 53 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain JH9)
Q2FW11 2.85e-33 114 53 0 109 1 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEP4 2.85e-33 114 53 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain USA300)
A6U3X0 2.85e-33 114 53 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain JH1)
A7X5F6 2.85e-33 114 53 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain Mu3 / ATCC 700698)
P23311 3.19e-33 114 50 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacillus stearothermophilus
Q1WS95 4.44e-33 114 55 0 104 3 rplV Large ribosomal subunit protein uL22 Ligilactobacillus salivarius (strain UCC118)
B9LJD7 4.99e-33 114 53 0 110 3 rplV Large ribosomal subunit protein uL22 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WH71 4.99e-33 114 53 0 110 3 rplV Large ribosomal subunit protein uL22 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B8D0C9 5.05e-33 114 53 0 110 3 rplV Large ribosomal subunit protein uL22 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q4L8A9 5.25e-33 114 53 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus haemolyticus (strain JCSC1435)
Q8CRG5 5.25e-33 114 53 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM04 5.25e-33 114 53 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q3A9S1 5.27e-33 114 53 0 110 3 rplV Large ribosomal subunit protein uL22 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q3A6P2 5.51e-33 114 51 0 110 3 rplV Large ribosomal subunit protein uL22 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A3CK68 6.33e-33 114 55 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus sanguinis (strain SK36)
Q5XED0 7.14e-33 114 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
C0MCB5 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus equi subsp. zooepidemicus (strain H70)
B5XJ41 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M49 (strain NZ131)
P0C0D3 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes
P0DE23 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VU4 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC19 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J909 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ57 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JP12 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE53 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CNQ0 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DE22 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0D4 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M1
B4U505 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M7R4 7.21e-33 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus equi subsp. equi (strain 4047)
C4XLX8 1.03e-32 113 53 0 109 3 rplV Large ribosomal subunit protein uL22 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A8AZM0 1.05e-32 113 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q6F1Y9 1.27e-32 113 55 0 109 3 rplV Large ribosomal subunit protein uL22 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q03IF6 1.64e-32 112 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M2B8 1.64e-32 112 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXR6 1.64e-32 112 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus thermophilus (strain CNRZ 1066)
Q9Z9K9 1.72e-32 112 50 0 110 3 rplV Large ribosomal subunit protein uL22 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8ZV62 1.75e-32 112 51 2 111 3 rplV Large ribosomal subunit protein uL22 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q38UR7 1.81e-32 112 57 0 100 3 rplV Large ribosomal subunit protein uL22 Latilactobacillus sakei subsp. sakei (strain 23K)
Q03PW2 2.24e-32 112 55 0 106 3 rplV Large ribosomal subunit protein uL22 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B9DSV5 2.43e-32 112 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q034Y8 3.19e-32 112 55 0 100 3 rplV Large ribosomal subunit protein uL22 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAL2 3.19e-32 112 55 0 100 3 rplV Large ribosomal subunit protein uL22 Lacticaseibacillus casei (strain BL23)
Q8E2C7 3.64e-32 112 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7T4 3.64e-32 112 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3W4 3.64e-32 112 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q30Z47 3.69e-32 111 47 0 109 3 rplV Large ribosomal subunit protein uL22 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q88XY1 5.43e-32 111 53 0 106 3 rplV Large ribosomal subunit protein uL22 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B0SSH2 5.76e-32 111 52 1 110 3 rplV Large ribosomal subunit protein uL22 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SA42 6.52e-32 111 52 1 110 3 rplV Large ribosomal subunit protein uL22 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q67JU8 9.77e-32 110 51 0 110 3 rplV Large ribosomal subunit protein uL22 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A6LPR6 1.07e-31 110 50 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A7NR58 1.45e-31 110 54 0 109 3 rplV Large ribosomal subunit protein uL22 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q8DS19 1.59e-31 110 52 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A5USI4 1.67e-31 110 54 0 109 3 rplV Large ribosomal subunit protein uL22 Roseiflexus sp. (strain RS-1)
Q5WLQ7 2.66e-31 109 50 0 106 3 rplV Large ribosomal subunit protein uL22 Shouchella clausii (strain KSM-K16)
Q97EI3 2.97e-31 109 50 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A4XLS5 3.14e-31 109 52 0 106 3 rplV Large ribosomal subunit protein uL22 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
C4ZBS4 3.23e-31 110 54 1 105 3 rplV Large ribosomal subunit protein uL22 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
C1CP93 4.12e-31 109 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIA2 4.12e-31 109 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain P1031)
C1CC11 4.12e-31 109 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain JJA)
P61183 4.12e-31 109 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS45 4.12e-31 109 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain CGSP14)
P61182 4.12e-31 109 53 0 106 1 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKG2 4.12e-31 109 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8K3 4.12e-31 109 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAL7 4.12e-31 109 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain 70585)
B5E6G0 4.12e-31 109 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae serotype 19F (strain G54)
Q04MN1 4.12e-31 109 53 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q1MPQ8 4.15e-31 109 48 0 109 3 rplV Large ribosomal subunit protein uL22 Lawsonia intracellularis (strain PHE/MN1-00)
Q49ZG3 4.45e-31 109 51 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q02W29 4.48e-31 109 53 0 106 3 rplV Large ribosomal subunit protein uL22 Lactococcus lactis subsp. cremoris (strain SK11)
A2RNQ0 4.48e-31 109 53 0 106 1 rplV Large ribosomal subunit protein uL22 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CDW7 4.48e-31 109 53 0 106 3 rplV Large ribosomal subunit protein uL22 Lactococcus lactis subsp. lactis (strain IL1403)
Q890P2 1.02e-30 108 50 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridium tetani (strain Massachusetts / E88)
Q39Y01 1.12e-30 108 49 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A5N4Q2 1.27e-30 107 48 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYB4 1.27e-30 107 48 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridium kluyveri (strain NBRC 12016)
Q2LQ96 1.31e-30 107 53 0 110 3 rplV Large ribosomal subunit protein uL22 Syntrophus aciditrophicus (strain SB)
Q2RFQ2 1.34e-30 107 52 0 110 3 rplV Large ribosomal subunit protein uL22 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A9KJI9 1.53e-30 108 50 0 102 3 rplV Large ribosomal subunit protein uL22 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A4VSF9 1.69e-30 107 52 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus suis (strain 05ZYH33)
A4VYP8 1.69e-30 107 52 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus suis (strain 98HAH33)
B2G8X3 1.78e-30 107 54 0 106 3 rplV Large ribosomal subunit protein uL22 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLK0 1.78e-30 107 54 0 106 3 rplV Large ribosomal subunit protein uL22 Limosilactobacillus reuteri (strain DSM 20016)
P10139 1.89e-30 107 54 0 109 3 rplV Large ribosomal subunit protein uL22 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
A7HM47 1.92e-30 108 50 0 110 3 rplV Large ribosomal subunit protein uL22 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q04C10 2.19e-30 107 52 0 102 3 rplV Large ribosomal subunit protein uL22 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBL3 2.19e-30 107 52 0 102 3 rplV Large ribosomal subunit protein uL22 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A6W5U3 3.57e-30 107 50 1 113 3 rplV Large ribosomal subunit protein uL22 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q1QN25 3.95e-30 107 54 0 106 3 rplV Large ribosomal subunit protein uL22 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B8IYH7 5.3e-30 106 47 0 109 3 rplV Large ribosomal subunit protein uL22 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q98PY6 5.59e-30 106 47 0 110 3 rplV Large ribosomal subunit protein uL22 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q6KI50 5.96e-30 106 50 0 110 3 rplV Large ribosomal subunit protein uL22 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
B3E7U0 9.43e-30 105 52 0 109 3 rplV Large ribosomal subunit protein uL22 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A6LLL8 1.01e-29 107 49 0 109 3 rplV Large ribosomal subunit protein uL22 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
C6E4Q2 1.29e-29 105 49 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacter sp. (strain M21)
B5EFQ5 1.29e-29 105 49 0 110 3 rplV Large ribosomal subunit protein uL22 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q74L84 1.33e-29 105 52 0 103 3 rplV Large ribosomal subunit protein uL22 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q046C0 1.33e-29 105 52 0 103 3 rplV Large ribosomal subunit protein uL22 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
B0RZU5 1.39e-29 105 49 0 110 3 rplV Large ribosomal subunit protein uL22 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B9M6H3 1.44e-29 105 49 0 110 3 rplV Large ribosomal subunit protein uL22 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q47LJ8 1.5e-29 105 52 0 110 3 rplV Large ribosomal subunit protein uL22 Thermobifida fusca (strain YX)
C5C0I6 1.59e-29 105 49 2 115 3 rplV Large ribosomal subunit protein uL22 Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q3SSW1 1.72e-29 105 53 0 106 3 rplV Large ribosomal subunit protein uL22 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q748Z3 1.85e-29 105 50 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q6MSN0 2.02e-29 105 53 0 109 3 rplV Large ribosomal subunit protein uL22 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
O31160 2.24e-29 104 54 0 109 3 rplV Large ribosomal subunit protein uL22 Spiroplasma citri
A8YXL0 2.45e-29 104 52 0 103 3 rplV Large ribosomal subunit protein uL22 Lactobacillus helveticus (strain DPC 4571)
Q9L0D5 2.73e-29 104 52 1 111 3 rplV Large ribosomal subunit protein uL22 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q82DP0 2.73e-29 104 52 1 111 3 rplV Large ribosomal subunit protein uL22 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q1XDH9 2.73e-29 104 49 0 108 3 rpl22 Large ribosomal subunit protein uL22c Neopyropia yezoensis
A4FPM0 2.73e-29 105 51 0 107 3 rplV Large ribosomal subunit protein uL22 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A1VEB1 3.05e-29 104 48 0 109 3 rplV Large ribosomal subunit protein uL22 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CH5 3.05e-29 104 48 0 109 3 rplV Large ribosomal subunit protein uL22 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A1ALU6 3.06e-29 104 49 0 109 3 rplV Large ribosomal subunit protein uL22 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A9WSV4 3.06e-29 104 52 2 113 3 rplV Large ribosomal subunit protein uL22 Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
A6TWH7 3.39e-29 104 47 0 110 3 rplV Large ribosomal subunit protein uL22 Alkaliphilus metalliredigens (strain QYMF)
Q5FM85 3.67e-29 104 52 0 103 3 rplV Large ribosomal subunit protein uL22 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A1R8U0 3.73e-29 104 51 2 113 3 rplV Large ribosomal subunit protein uL22 Paenarthrobacter aurescens (strain TC1)
Q3ZZL9 3.88e-29 104 50 0 109 3 rplV Large ribosomal subunit protein uL22 Dehalococcoides mccartyi (strain CBDB1)
A5FRY0 3.88e-29 104 50 0 109 3 rplV Large ribosomal subunit protein uL22 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
B2IK67 4.15e-29 104 53 0 108 3 rplV Large ribosomal subunit protein uL22 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A9NED8 4.15e-29 103 50 0 110 3 rplV Large ribosomal subunit protein uL22 Acholeplasma laidlawii (strain PG-8A)
Q18CG1 5e-29 103 48 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridioides difficile (strain 630)
B7IHV1 6.18e-29 104 50 0 108 3 rplV Large ribosomal subunit protein uL22 Thermosipho africanus (strain TCF52B)
Q3Z976 6.85e-29 103 49 0 109 3 rplV Large ribosomal subunit protein uL22 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q6A6N1 6.94e-29 104 51 0 105 1 rplV Large ribosomal subunit protein uL22 Cutibacterium acnes (strain DSM 16379 / KPA171202)
B8FET0 9.98e-29 103 48 1 107 3 rplV Large ribosomal subunit protein uL22 Desulfatibacillum aliphaticivorans
A5GAX0 1.1e-28 103 48 0 110 3 rplV Large ribosomal subunit protein uL22 Geotalea uraniireducens (strain Rf4)
Q01W97 1.3e-28 102 48 1 111 3 rplV Large ribosomal subunit protein uL22 Solibacter usitatus (strain Ellin6076)
A8LC51 1.43e-28 103 50 0 106 3 rplV Large ribosomal subunit protein uL22 Parafrankia sp. (strain EAN1pec)
B8ELF8 1.45e-28 103 50 0 108 3 rplV Large ribosomal subunit protein uL22 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
P51309 1.7e-28 102 48 0 108 3 rpl22 Large ribosomal subunit protein uL22c Porphyra purpurea
A5IYY1 1.73e-28 102 50 0 106 3 rplV Large ribosomal subunit protein uL22 Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
C5CC57 1.82e-28 102 47 1 115 3 rplV Large ribosomal subunit protein uL22 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
A9BHA0 1.87e-28 103 46 0 110 3 rplV Large ribosomal subunit protein uL22 Petrotoga mobilis (strain DSM 10674 / SJ95)
B2GDW4 1.97e-28 102 51 0 106 3 rplV Large ribosomal subunit protein uL22 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A0JZ79 2.31e-28 102 50 2 113 3 rplV Large ribosomal subunit protein uL22 Arthrobacter sp. (strain FB24)
B9KZY2 2.58e-28 102 49 0 109 3 rplV Large ribosomal subunit protein uL22 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
B2A4E4 2.88e-28 102 48 0 110 3 rplV Large ribosomal subunit protein uL22 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q4G360 3.41e-28 102 50 0 108 3 rpl22 Large ribosomal subunit protein uL22c Emiliania huxleyi
B1W402 3.51e-28 102 51 1 111 3 rplV Large ribosomal subunit protein uL22 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q2JV86 3.58e-28 102 49 0 106 3 rplV Large ribosomal subunit protein uL22 Synechococcus sp. (strain JA-3-3Ab)
A1SNL3 3.61e-28 102 52 0 104 3 rplV Large ribosomal subunit protein uL22 Nocardioides sp. (strain ATCC BAA-499 / JS614)
P73315 3.73e-28 102 51 0 107 3 rplV Large ribosomal subunit protein uL22 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B3PMP2 4.1e-28 104 54 0 99 3 rplV Large ribosomal subunit protein uL22 Metamycoplasma arthritidis (strain 158L3-1)
Q5LW57 4.49e-28 102 51 0 106 3 rplV Large ribosomal subunit protein uL22 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q07KM3 4.9e-28 102 50 0 106 3 rplV Large ribosomal subunit protein uL22 Rhodopseudomonas palustris (strain BisA53)
Q8G080 8.51e-28 101 52 0 108 3 rplV Large ribosomal subunit protein uL22 Brucella suis biovar 1 (strain 1330)
B8DNA1 8.81e-28 100 45 0 109 3 rplV Large ribosomal subunit protein uL22 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q8UE23 9.39e-28 101 52 0 108 3 rplV Large ribosomal subunit protein uL22 Agrobacterium fabrum (strain C58 / ATCC 33970)
O66094 9.51e-28 101 54 0 96 3 rplV Large ribosomal subunit protein uL22 Phytoplasma sp. (strain STRAWB1)
Q2JIM2 1.31e-27 100 49 0 106 3 rplV Large ribosomal subunit protein uL22 Synechococcus sp. (strain JA-2-3B'a(2-13))
A8M524 1.57e-27 101 52 0 100 3 rplV Large ribosomal subunit protein uL22 Salinispora arenicola (strain CNS-205)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16175
Feature type CDS
Gene rplV
Product 50S ribosomal protein L22
Location 3585434 - 3585766 (strand: 1)
Length 333 (nucleotides) / 110 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2427
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00237 Ribosomal protein L22p/L17e

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0091 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L22

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02890 large subunit ribosomal protein L22 Ribosome -

Protein Sequence

METIAIHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAGLVKKVLESAIANAEHNDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR

Flanking regions ( +/- flanking 50bp)

GGTCATGCAGCCGATAAAAAGGCTAAGAAGAAATAAGGTAGGAGGAAGAGATGGAAACTATCGCTATACATCGCCACGCTCGTTCTTCTGCTCAGAAGGTTCGCCTGGTGGCAGACCTGATTCGCGGTAAGAAAGTGTCGCAAGCTCTGGAAACTCTGACCTATACCAACAAGAAAGCTGCTGGTTTAGTGAAGAAAGTACTCGAGTCTGCTATTGCTAATGCAGAACACAACGATGGCGCTGACATTGATGATCTGAAAGTAGCTAAGATCTTTGTTGACGAAGGTCCTTCTATGAAGCGCATTATGCCTCGTGCAAAAGGCCGTGCAGATCGTATTCTGAAGCGCACCAGCCACATCACTGTGGTTGTGTCCGATCGCTGAGACTCTGGAGACTAGCAATGGGTCAAAAAGTACATCCTAATGGTATCCGC