Homologs in group_2427

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19220 FBDBKF_19220 99.1 Morganella morganii S1 rplV 50S ribosomal protein L22
EHELCC_18965 EHELCC_18965 99.1 Morganella morganii S2 rplV 50S ribosomal protein L22
NLDBIP_18980 NLDBIP_18980 99.1 Morganella morganii S4 rplV 50S ribosomal protein L22
LHKJJB_18835 LHKJJB_18835 99.1 Morganella morganii S3 rplV 50S ribosomal protein L22
HKOGLL_18570 HKOGLL_18570 99.1 Morganella morganii S5 rplV 50S ribosomal protein L22
PMI_RS16175 PMI_RS16175 94.5 Proteus mirabilis HI4320 rplV 50S ribosomal protein L22

Distribution of the homologs in the orthogroup group_2427

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2427

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1I9 8.6e-71 209 94 0 110 3 rplV Large ribosomal subunit protein uL22 Proteus mirabilis (strain HI4320)
Q2NQM7 1.74e-70 208 94 0 110 3 rplV Large ribosomal subunit protein uL22 Sodalis glossinidius (strain morsitans)
A1JS31 2.49e-70 208 94 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GKJ2 2.49e-70 208 94 0 110 3 rplV Large ribosomal subunit protein uL22 Serratia proteamaculans (strain 568)
B1JIW6 9.41e-70 206 93 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664S6 9.41e-70 206 93 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGZ7 9.41e-70 206 93 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pestis (strain Pestoides F)
Q1CCU9 9.41e-70 206 93 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R901 9.41e-70 206 93 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJA7 9.41e-70 206 93 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pestis
B2K5M5 9.41e-70 206 93 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2V2 9.41e-70 206 93 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNN0 9.41e-70 206 93 0 110 3 rplV Large ribosomal subunit protein uL22 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7MYF6 9.41e-70 206 93 0 110 3 rplV Large ribosomal subunit protein uL22 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DG69 1.1e-69 206 93 0 110 3 rplV Large ribosomal subunit protein uL22 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZX5 1.1e-69 206 93 0 110 3 rplV Large ribosomal subunit protein uL22 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TEW7 9.64e-69 204 92 0 110 3 rplV Large ribosomal subunit protein uL22 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XN99 9.64e-69 204 92 0 110 3 rplV Large ribosomal subunit protein uL22 Klebsiella pneumoniae (strain 342)
Q3YWU4 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Shigella sonnei (strain Ss046)
Q32B36 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VW1 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Shigella boydii serotype 4 (strain Sb227)
B2U2T3 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P61179 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P61178 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella typhi
B4TXD7 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella schwarzengrund (strain CVM19633)
B5BGY1 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella paratyphi A (strain AKU_12601)
C0Q0B1 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella paratyphi C (strain RKS4594)
A9MSZ3 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIV7 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUT5 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella newport (strain SL254)
B4TKL0 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella heidelberg (strain SL476)
B5RH20 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R286 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella enteritidis PT4 (strain P125109)
B5FJK9 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella dublin (strain CT_02021853)
B5F8E7 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella agona (strain SL483)
B7LRT1 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R610 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain UTI89 / UPEC)
B1LHC9 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain SMS-3-5 / SECEC)
B6I229 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain SE11)
B7NDT6 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P61175 2.74e-68 203 92 0 110 1 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain K12)
B1IPY4 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P61176 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCE6 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGK3 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O1:K1 / APEC
A8A5C0 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O9:H4 (strain HS)
B1X6G6 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain K12 / DH10B)
C4ZUH0 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1M9 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O8 (strain IAI1)
B7N199 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O81 (strain ED1a)
B7NLN4 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTN6 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P61177 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O157:H7
B7L4K4 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli (strain 55989 / EAEC)
B7MCT0 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK39 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSK4 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Escherichia coli O139:H28 (strain E24377A / ETEC)
A7MPI4 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Cronobacter sakazakii (strain ATCC BAA-894)
A8AQL2 2.74e-68 203 92 0 110 3 rplV Large ribosomal subunit protein uL22 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MN53 3.52e-68 202 91 0 110 3 rplV Large ribosomal subunit protein uL22 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4WFC3 3.64e-68 202 91 0 110 3 rplV Large ribosomal subunit protein uL22 Enterobacter sp. (strain 638)
B2VK59 4.02e-68 202 91 0 110 3 rplV Large ribosomal subunit protein uL22 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P44360 4.79e-68 202 90 0 110 3 rplV Large ribosomal subunit protein uL22 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHT5 4.79e-68 202 90 0 110 3 rplV Large ribosomal subunit protein uL22 Haemophilus influenzae (strain PittGG)
A5UDU2 4.79e-68 202 90 0 110 3 rplV Large ribosomal subunit protein uL22 Haemophilus influenzae (strain PittEE)
Q4QMB7 4.79e-68 202 90 0 110 3 rplV Large ribosomal subunit protein uL22 Haemophilus influenzae (strain 86-028NP)
Q0I158 7.76e-68 202 90 0 110 3 rplV Large ribosomal subunit protein uL22 Histophilus somni (strain 129Pt)
B0BST6 7.76e-68 202 90 0 110 3 rplV Large ribosomal subunit protein uL22 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ16 7.76e-68 202 90 0 110 3 rplV Large ribosomal subunit protein uL22 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N363 7.76e-68 202 90 0 110 3 rplV Large ribosomal subunit protein uL22 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VKD6 2.04e-67 201 89 0 110 3 rplV Large ribosomal subunit protein uL22 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P55838 2.57e-67 200 89 0 110 3 rplV Large ribosomal subunit protein uL22 Aggregatibacter actinomycetemcomitans
Q83PY5 2.87e-67 200 91 0 110 3 rplV Large ribosomal subunit protein uL22 Shigella flexneri
Q0SZY7 2.87e-67 200 91 0 110 3 rplV Large ribosomal subunit protein uL22 Shigella flexneri serotype 5b (strain 8401)
B8F760 3.06e-67 200 90 0 110 3 rplV Large ribosomal subunit protein uL22 Glaesserella parasuis serovar 5 (strain SH0165)
B0UX18 3.69e-67 200 89 0 110 3 rplV Large ribosomal subunit protein uL22 Histophilus somni (strain 2336)
Q9CL36 6.31e-67 199 90 0 110 3 rplV Large ribosomal subunit protein uL22 Pasteurella multocida (strain Pm70)
A6VLJ3 1.49e-66 198 89 0 110 3 rplV Large ribosomal subunit protein uL22 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65QW0 6.12e-66 197 88 0 110 3 rplV Large ribosomal subunit protein uL22 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q1LTD3 9.37e-62 186 83 0 110 3 rplV Large ribosomal subunit protein uL22 Baumannia cicadellinicola subsp. Homalodisca coagulata
C4K7B3 1.63e-61 186 84 0 109 3 rplV Large ribosomal subunit protein uL22 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q87T08 4.75e-61 184 84 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B8D844 9.18e-61 184 80 0 110 3 rplV Large ribosomal subunit protein uL22 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57586 9.18e-61 184 80 0 110 3 rplV Large ribosomal subunit protein uL22 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9U2 9.18e-61 184 80 0 110 3 rplV Large ribosomal subunit protein uL22 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q7MPI3 2.09e-60 183 84 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio vulnificus (strain YJ016)
Q8DE44 2.09e-60 183 84 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio vulnificus (strain CMCP6)
A7MWI8 2.09e-60 183 84 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio campbellii (strain ATCC BAA-1116)
Q6LVB1 4.76e-60 182 82 0 110 3 rplV Large ribosomal subunit protein uL22 Photobacterium profundum (strain SS9)
C3LRQ3 8.72e-59 179 81 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNY9 8.72e-59 179 81 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F544 8.72e-59 179 81 0 110 3 rplV Large ribosomal subunit protein uL22 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q8K955 2.42e-58 177 78 0 110 3 rplV Large ribosomal subunit protein uL22 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B5FG14 1.08e-57 176 80 0 110 3 rplV Large ribosomal subunit protein uL22 Aliivibrio fischeri (strain MJ11)
Q5E8B0 1.08e-57 176 80 0 110 3 rplV Large ribosomal subunit protein uL22 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1S223 1.84e-57 176 79 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A3Q987 2.98e-57 175 79 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B6EPT0 4.62e-57 174 79 0 110 3 rplV Large ribosomal subunit protein uL22 Aliivibrio salmonicida (strain LFI1238)
A1REB9 6.22e-57 174 79 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella sp. (strain W3-18-1)
Q0I0A0 6.22e-57 174 79 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella sp. (strain MR-7)
Q0HNT2 6.22e-57 174 79 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella sp. (strain MR-4)
A0KRM9 6.22e-57 174 79 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella sp. (strain ANA-3)
A4YBX8 6.22e-57 174 79 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EK63 6.22e-57 174 79 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q089P9 6.22e-57 174 79 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella frigidimarina (strain NCIMB 400)
A9KWA7 6.22e-57 174 79 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella baltica (strain OS195)
A6WHT3 6.22e-57 174 79 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella baltica (strain OS185)
A3DA67 6.22e-57 174 79 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBK0 6.22e-57 174 79 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella baltica (strain OS223)
Q12SV4 1.76e-56 173 78 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q15YN4 2.15e-55 170 75 0 109 3 rplV Large ribosomal subunit protein uL22 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
P59558 3.26e-55 170 75 0 109 3 rplV Large ribosomal subunit protein uL22 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q487Z8 6.03e-55 169 77 0 109 3 rplV Large ribosomal subunit protein uL22 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B1KMX8 8.47e-55 169 76 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella woodyi (strain ATCC 51908 / MS32)
A8G1E3 8.47e-55 169 76 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella sediminis (strain HAW-EB3)
B8CND8 8.47e-55 169 76 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8GYY1 8.47e-55 169 76 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TM07 8.47e-55 169 76 0 110 3 rplV Large ribosomal subunit protein uL22 Shewanella halifaxensis (strain HAW-EB4)
B4S096 9.35e-55 169 76 0 109 3 rplV Large ribosomal subunit protein uL22 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q3IF20 1.75e-54 168 77 0 109 3 rplV Large ribosomal subunit protein uL22 Pseudoalteromonas translucida (strain TAC 125)
Q5QXY2 3.93e-54 167 76 0 109 3 rplV Large ribosomal subunit protein uL22 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A0KF26 7.23e-54 166 77 0 109 3 rplV Large ribosomal subunit protein uL22 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q493K3 2.18e-53 165 71 0 109 3 rplV Large ribosomal subunit protein uL22 Blochmanniella pennsylvanica (strain BPEN)
A4ST01 3.54e-53 165 77 0 109 3 rplV Large ribosomal subunit protein uL22 Aeromonas salmonicida (strain A449)
A1T0D7 1.37e-52 163 71 0 110 3 rplV Large ribosomal subunit protein uL22 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q8D207 1.58e-52 163 68 0 110 3 rplV Large ribosomal subunit protein uL22 Wigglesworthia glossinidia brevipalpis
Q7VQE3 1.47e-51 160 70 0 109 3 rplV Large ribosomal subunit protein uL22 Blochmanniella floridana
Q605B7 5.48e-51 159 69 0 109 3 rplV Large ribosomal subunit protein uL22 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q21M52 1.59e-48 153 70 0 110 3 rplV Large ribosomal subunit protein uL22 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q4ZMP9 1.89e-48 153 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas syringae pv. syringae (strain B728a)
Q889W6 1.89e-48 153 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48D41 1.89e-48 153 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1JDV9 2.13e-48 152 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas putida (strain W619)
Q88QN0 2.13e-48 152 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK72 2.13e-48 152 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas putida (strain GB-1)
Q3K5Z3 2.13e-48 152 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas fluorescens (strain Pf0-1)
A5VXQ2 2.13e-48 152 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4XZ85 2.13e-48 152 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas mendocina (strain ymp)
C3K2X1 2.13e-48 152 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas fluorescens (strain SBW25)
Q4K538 2.13e-48 152 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1IFW1 2.13e-48 152 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas entomophila (strain L48)
Q9HWE0 2.13e-48 152 68 0 110 1 rplV Large ribosomal subunit protein uL22 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T75 2.13e-48 152 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V649 2.13e-48 152 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas aeruginosa (strain LESB58)
A6UZJ3 2.13e-48 152 68 0 110 3 rplV Large ribosomal subunit protein uL22 Pseudomonas aeruginosa (strain PA7)
C5BQ66 3.13e-48 152 70 0 110 3 rplV Large ribosomal subunit protein uL22 Teredinibacter turnerae (strain ATCC 39867 / T7901)
A1WVB7 5.01e-48 152 68 0 109 3 rplV Large ribosomal subunit protein uL22 Halorhodospira halophila (strain DSM 244 / SL1)
Q0ABH0 8.29e-48 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A4VHN5 9.16e-48 151 68 0 110 3 rplV Large ribosomal subunit protein uL22 Stutzerimonas stutzeri (strain A1501)
Q2S917 2.46e-47 150 68 0 109 3 rplV Large ribosomal subunit protein uL22 Hahella chejuensis (strain KCTC 2396)
B0V6X3 1.69e-46 148 71 0 107 3 rplV Large ribosomal subunit protein uL22 Acinetobacter baumannii (strain AYE)
B0VQS3 1.69e-46 148 71 0 107 3 rplV Large ribosomal subunit protein uL22 Acinetobacter baumannii (strain SDF)
B2HZL7 1.69e-46 148 71 0 107 3 rplV Large ribosomal subunit protein uL22 Acinetobacter baumannii (strain ACICU)
Q6F7R7 1.91e-46 147 71 0 107 3 rplV Large ribosomal subunit protein uL22 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A1KRH8 2.09e-46 147 67 0 109 3 rplV Large ribosomal subunit protein uL22 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7DDT5 2.09e-46 147 67 0 109 1 rplV Large ribosomal subunit protein uL22 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JRD8 2.09e-46 147 67 0 109 3 rplV Large ribosomal subunit protein uL22 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3W1 2.09e-46 147 67 0 109 3 rplV Large ribosomal subunit protein uL22 Neisseria meningitidis serogroup C (strain 053442)
B4RQY3 2.09e-46 147 67 0 109 3 rplV Large ribosomal subunit protein uL22 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5T2 2.09e-46 147 67 0 109 3 rplV Large ribosomal subunit protein uL22 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B3PK42 2.65e-46 147 69 0 110 3 rplV Large ribosomal subunit protein uL22 Cellvibrio japonicus (strain Ueda107)
B8GV53 5.18e-46 147 66 0 109 3 rplV Large ribosomal subunit protein uL22 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1AVK5 1.97e-45 145 69 0 107 3 rplV Large ribosomal subunit protein uL22 Ruthia magnifica subsp. Calyptogena magnifica
A5WCJ5 2.49e-45 145 68 0 109 3 rplV Large ribosomal subunit protein uL22 Psychrobacter sp. (strain PRwf-1)
A6W387 3.93e-45 144 69 0 108 3 rplV Large ribosomal subunit protein uL22 Marinomonas sp. (strain MWYL1)
A1TYK2 4.39e-45 144 65 0 110 3 rplV Large ribosomal subunit protein uL22 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A5CXK9 6.16e-45 144 69 0 104 3 rplV Large ribosomal subunit protein uL22 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
C1DAS2 9.37e-45 143 66 0 109 3 rplV Large ribosomal subunit protein uL22 Laribacter hongkongensis (strain HLHK9)
A4IZS9 3.18e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHW3 3.18e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNS2 3.18e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4I8 3.18e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. novicida (strain U112)
B2SDY0 3.18e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5G5 3.18e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. holarctica (strain LVS)
A7N9T1 3.18e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14JB5 3.18e-44 142 65 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella tularensis subsp. tularensis (strain FSC 198)
Q31IX7 6.02e-44 141 64 0 110 3 rplV Large ribosomal subunit protein uL22 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A1W2R2 1.45e-43 140 70 0 108 3 rplV Large ribosomal subunit protein uL22 Acidovorax sp. (strain JS42)
B9MB78 1.45e-43 140 70 0 108 3 rplV Large ribosomal subunit protein uL22 Acidovorax ebreus (strain TPSY)
A9IIZ3 1.91e-43 140 67 0 107 3 rplV Large ribosomal subunit protein uL22 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q1LI42 3.68e-43 139 65 0 109 3 rplV Large ribosomal subunit protein uL22 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1QDI1 4.79e-43 139 64 0 109 3 rplV Large ribosomal subunit protein uL22 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FUF1 4.79e-43 139 64 0 109 3 rplV Large ribosomal subunit protein uL22 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
O85387 6.35e-43 139 63 0 109 3 rplV Large ribosomal subunit protein uL22 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAM9 6.35e-43 139 63 0 109 3 rplV Large ribosomal subunit protein uL22 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD26 6.35e-43 139 63 0 109 3 rplV Large ribosomal subunit protein uL22 Coxiella burnetii (strain Dugway 5J108-111)
B6J258 6.35e-43 139 63 0 109 3 rplV Large ribosomal subunit protein uL22 Coxiella burnetii (strain CbuG_Q212)
B6J5D7 6.7e-43 139 63 0 109 3 rplV Large ribosomal subunit protein uL22 Coxiella burnetii (strain CbuK_Q154)
B0U0Y4 7.15e-43 139 63 0 110 3 rplV Large ribosomal subunit protein uL22 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B1Y8I2 7.34e-43 139 65 0 109 3 rplV Large ribosomal subunit protein uL22 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q12GW6 1.33e-42 138 66 0 109 3 rplV Large ribosomal subunit protein uL22 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q47J98 1.65e-42 137 65 0 109 3 rplV Large ribosomal subunit protein uL22 Dechloromonas aromatica (strain RCB)
A1KB22 1.93e-42 137 64 0 109 3 rplV Large ribosomal subunit protein uL22 Azoarcus sp. (strain BH72)
Q1H4N2 2.13e-42 137 66 0 109 3 rplV Large ribosomal subunit protein uL22 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q46WE9 2.37e-42 137 63 0 109 3 rplV Large ribosomal subunit protein uL22 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K624 2.37e-42 137 63 0 109 3 rplV Large ribosomal subunit protein uL22 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A1VIQ5 3.88e-42 137 65 0 109 3 rplV Large ribosomal subunit protein uL22 Polaromonas naphthalenivorans (strain CJ2)
Q7VTC8 4.48e-42 137 67 0 107 3 rplV Large ribosomal subunit protein uL22 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2F1 4.48e-42 137 67 0 107 3 rplV Large ribosomal subunit protein uL22 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRC0 4.48e-42 137 67 0 107 3 rplV Large ribosomal subunit protein uL22 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2L2E3 4.48e-42 137 67 0 107 3 rplV Large ribosomal subunit protein uL22 Bordetella avium (strain 197N)
A9BPS3 5.32e-42 136 66 0 108 3 rplV Large ribosomal subunit protein uL22 Delftia acidovorans (strain DSM 14801 / SPH-1)
B2UEL4 5.51e-42 136 61 0 109 3 rplV Large ribosomal subunit protein uL22 Ralstonia pickettii (strain 12J)
B3R7R8 5.7e-42 136 62 0 109 3 rplV Large ribosomal subunit protein uL22 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B4SKW8 5.79e-42 136 64 0 108 3 rplV Large ribosomal subunit protein uL22 Stenotrophomonas maltophilia (strain R551-3)
B2FQ50 6.36e-42 136 64 0 108 3 rplV Large ribosomal subunit protein uL22 Stenotrophomonas maltophilia (strain K279a)
A6T3J9 7.72e-42 136 64 0 109 3 rplV Large ribosomal subunit protein uL22 Janthinobacterium sp. (strain Marseille)
A1TJ12 9.2e-42 136 66 0 108 3 rplV Large ribosomal subunit protein uL22 Paracidovorax citrulli (strain AAC00-1)
Q3SLP4 1.12e-41 135 65 0 109 3 rplV Large ribosomal subunit protein uL22 Thiobacillus denitrificans (strain ATCC 25259)
Q7CLU6 2.22e-41 135 64 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU77 2.22e-41 135 64 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas campestris pv. campestris (strain B100)
Q4URE4 2.22e-41 135 64 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas campestris pv. campestris (strain 8004)
Q8NKY0 2.22e-41 135 64 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas axonopodis pv. citri (strain 306)
Q3BWX8 2.3e-41 135 64 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B2SQR5 3.81e-41 134 63 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas oryzae pv. oryzae (strain PXO99A)
C5CP48 3.87e-41 134 64 0 108 3 rplV Large ribosomal subunit protein uL22 Variovorax paradoxus (strain S110)
Q5GWT9 3.88e-41 134 63 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZZ0 3.88e-41 134 63 0 107 3 rplV Large ribosomal subunit protein uL22 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8XV17 8.81e-41 133 61 0 109 3 rplV Large ribosomal subunit protein uL22 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q5WZK7 1.1e-40 133 64 0 109 3 rplV Large ribosomal subunit protein uL22 Legionella pneumophila (strain Lens)
A5IHQ9 1.1e-40 133 64 0 109 3 rplV Large ribosomal subunit protein uL22 Legionella pneumophila (strain Corby)
Q5X854 1.1e-40 133 64 0 109 3 rplV Large ribosomal subunit protein uL22 Legionella pneumophila (strain Paris)
Q5ZYN8 1.34e-40 133 64 0 109 3 rplV Large ribosomal subunit protein uL22 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q7NQF7 1.92e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q21RW3 2e-40 132 63 0 109 3 rplV Large ribosomal subunit protein uL22 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q13TH5 2.34e-40 132 60 0 109 3 rplV Large ribosomal subunit protein uL22 Paraburkholderia xenovorans (strain LB400)
B2JI61 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A4JAP5 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2SU32 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q16 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia pseudomallei (strain K96243)
A3NEH4 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia pseudomallei (strain 668)
Q3JMR8 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia pseudomallei (strain 1710b)
A3P0A8 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia pseudomallei (strain 1106a)
Q1BRV3 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia orbicola (strain AU 1054)
B1JU27 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia orbicola (strain MC0-3)
A1V898 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia mallei (strain SAVP1)
Q62GL0 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia mallei (strain ATCC 23344)
A2S7I1 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia mallei (strain NCTC 10229)
A3MRV9 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia mallei (strain NCTC 10247)
A9ADJ8 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39KG2 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ41 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5C5 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3N0 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia cenocepacia (strain HI2424)
B1YRD5 2.36e-40 132 61 0 109 3 rplV Large ribosomal subunit protein uL22 Burkholderia ambifaria (strain MC40-6)
B2T746 2.75e-40 132 60 0 109 3 rplV Large ribosomal subunit protein uL22 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q5P327 4.18e-40 132 62 0 109 3 rplV Large ribosomal subunit protein uL22 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A4SUW6 5.2e-40 131 61 0 109 3 rplV Large ribosomal subunit protein uL22 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q2YAZ2 7.5e-40 131 60 0 110 3 rplV Large ribosomal subunit protein uL22 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1R0H0 8.21e-40 131 67 0 110 3 rplV Large ribosomal subunit protein uL22 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A5EX77 1.08e-39 130 63 0 110 3 rplV Large ribosomal subunit protein uL22 Dichelobacter nodosus (strain VCS1703A)
Q0VSJ8 1.23e-39 130 70 0 108 3 rplV Large ribosomal subunit protein uL22 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1WHD0 1.48e-39 130 64 0 108 3 rplV Large ribosomal subunit protein uL22 Verminephrobacter eiseniae (strain EF01-2)
B1XSQ6 2.05e-39 130 60 0 109 3 rplV Large ribosomal subunit protein uL22 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B0K5P8 2.27e-39 130 60 0 110 3 rplV Large ribosomal subunit protein uL22 Thermoanaerobacter sp. (strain X514)
B0KCK5 2.27e-39 130 60 0 110 3 rplV Large ribosomal subunit protein uL22 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q82X83 6.23e-39 129 56 0 110 3 rplV Large ribosomal subunit protein uL22 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A2SLF2 6.67e-39 129 64 0 109 3 rplV Large ribosomal subunit protein uL22 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A4G9T3 7.95e-39 128 60 0 109 3 rplV Large ribosomal subunit protein uL22 Herminiimonas arsenicoxydans
A4J116 1.55e-38 128 60 0 110 3 rplV Large ribosomal subunit protein uL22 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q81J37 2.1e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IZJ9 2.1e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain Q1)
B7HQU9 2.1e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain AH187)
B7HJ53 2.1e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain B4264)
B7IT24 2.1e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain G9842)
Q73F91 2.1e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain ATCC 10987 / NRS 248)
B5ELY4 2.49e-38 127 59 0 109 3 rplV Large ribosomal subunit protein uL22 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J472 2.49e-38 127 59 0 109 3 rplV Large ribosomal subunit protein uL22 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A9VP82 3.19e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus mycoides (strain KBAB4)
A7GK25 3.41e-38 127 59 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q6HPQ3 3.72e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H85 3.72e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain ZK / E33L)
C1ET44 3.72e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain 03BB102)
B7JKC4 3.72e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus cereus (strain AH820)
Q81VS5 3.72e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus anthracis
A0R8I5 3.72e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus thuringiensis (strain Al Hakam)
C3LJ87 3.72e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9R0 3.72e-38 127 60 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus anthracis (strain A0248)
Q250M7 6.41e-38 126 63 0 106 3 rplV Large ribosomal subunit protein uL22 Desulfitobacterium hafniense (strain Y51)
B8G1X1 1.81e-37 125 63 0 106 3 rplV Large ribosomal subunit protein uL22 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
C0ZII5 2.55e-37 124 59 0 110 3 rplV Large ribosomal subunit protein uL22 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q0AIJ0 2.69e-37 124 54 0 110 3 rplV Large ribosomal subunit protein uL22 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B0U5K4 3.96e-37 124 59 0 107 3 rplV Large ribosomal subunit protein uL22 Xylella fastidiosa (strain M12)
Q8R7V9 5.45e-37 124 58 0 110 3 rplV Large ribosomal subunit protein uL22 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A0L5X8 6.48e-37 124 56 0 107 3 rplV Large ribosomal subunit protein uL22 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q6MJ19 6.9e-37 124 54 0 110 3 rplV Large ribosomal subunit protein uL22 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B1LBN5 6.92e-37 125 55 0 110 3 rplV Large ribosomal subunit protein uL22 Thermotoga sp. (strain RQ2)
A5IM88 1.3e-36 124 54 0 110 3 rplV Large ribosomal subunit protein uL22 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9PE71 1.8e-36 122 59 0 107 3 rplV Large ribosomal subunit protein uL22 Xylella fastidiosa (strain 9a5c)
Q87E77 2.59e-36 122 58 0 107 3 rplV Large ribosomal subunit protein uL22 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8H4 2.59e-36 122 58 0 107 3 rplV Large ribosomal subunit protein uL22 Xylella fastidiosa (strain M23)
B1YGV5 2.93e-36 122 54 0 110 3 rplV Large ribosomal subunit protein uL22 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
P38511 3.4e-36 123 54 0 110 3 rplV Large ribosomal subunit protein uL22 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B1HMX5 3.93e-36 122 58 0 106 3 rplV Large ribosomal subunit protein uL22 Lysinibacillus sphaericus (strain C3-41)
A5D5J5 4.96e-36 121 58 0 110 3 rplV Large ribosomal subunit protein uL22 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A0PXV1 6.21e-36 121 52 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridium novyi (strain NT)
Q8RIG0 6.63e-36 121 59 0 109 3 rplV Large ribosomal subunit protein uL22 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q839F9 9.4e-36 121 56 0 106 1 rplV Large ribosomal subunit protein uL22 Enterococcus faecalis (strain ATCC 700802 / V583)
Q057A9 9.96e-36 121 62 0 109 3 rplV Large ribosomal subunit protein uL22 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q03EC1 1.18e-35 120 56 0 106 3 rplV Large ribosomal subunit protein uL22 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
C6C190 1.26e-35 120 58 0 109 3 rplV Large ribosomal subunit protein uL22 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A9B417 2.13e-35 120 56 0 109 3 rplV Large ribosomal subunit protein uL22 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q0AUI5 2.15e-35 120 56 0 110 3 rplV Large ribosomal subunit protein uL22 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A7Z0P3 3.15e-35 119 53 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P42060 3.15e-35 119 53 0 110 1 rplV Large ribosomal subunit protein uL22 Bacillus subtilis (strain 168)
C4KZP1 3.67e-35 119 58 0 100 3 rplV Large ribosomal subunit protein uL22 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A0ALW3 5.85e-35 119 56 0 105 3 rplV Large ribosomal subunit protein uL22 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q927L2 5.85e-35 119 56 0 105 1 rplV Large ribosomal subunit protein uL22 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB13 5.85e-35 119 56 0 105 3 rplV Large ribosomal subunit protein uL22 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WF1 5.85e-35 119 56 0 105 3 rplV Large ribosomal subunit protein uL22 Listeria monocytogenes serotype 4b (strain F2365)
C1KZH5 5.85e-35 119 56 0 105 3 rplV Large ribosomal subunit protein uL22 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q7ANU3 5.85e-35 119 56 0 105 3 rplV Large ribosomal subunit protein uL22 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B9E9J6 6.32e-35 119 54 0 110 3 rplV Large ribosomal subunit protein uL22 Macrococcus caseolyticus (strain JCSC5402)
C0MCB5 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus equi subsp. zooepidemicus (strain H70)
B5XJ41 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M49 (strain NZ131)
P0C0D3 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes
P0DE23 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VU4 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC19 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J909 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ57 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JP12 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE53 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CNQ0 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DE22 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0D4 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M1
B4U505 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M7R4 6.54e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus equi subsp. equi (strain 4047)
Q5XED0 6.76e-35 119 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A3CK68 7.54e-35 119 58 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus sanguinis (strain SK36)
Q3J8R9 7.81e-35 118 63 0 109 3 rplV Large ribosomal subunit protein uL22 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B2UMT4 7.84e-35 118 53 0 110 3 rplV Large ribosomal subunit protein uL22 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A8MLE5 8.07e-35 118 52 0 110 3 rplV Large ribosomal subunit protein uL22 Alkaliphilus oremlandii (strain OhILAs)
A8AZM0 1.32e-34 118 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A8F990 1.34e-34 118 54 0 110 3 rplV Large ribosomal subunit protein uL22 Bacillus pumilus (strain SAFR-032)
Q03IF6 1.45e-34 118 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M2B8 1.45e-34 118 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXR6 1.45e-34 118 57 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus thermophilus (strain CNRZ 1066)
B7GJ72 1.54e-34 117 53 0 110 3 rplV Large ribosomal subunit protein uL22 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A4IJJ4 1.64e-34 117 53 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacillus thermodenitrificans (strain NG80-2)
Q3A6P2 2.09e-34 117 53 0 110 3 rplV Large ribosomal subunit protein uL22 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q1WS95 2.1e-34 117 57 0 104 3 rplV Large ribosomal subunit protein uL22 Ligilactobacillus salivarius (strain UCC118)
B9DSV5 2.25e-34 117 56 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B9DM42 2.63e-34 117 55 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus carnosus (strain TM300)
A3DJH7 3.11e-34 117 54 0 106 3 rplV Large ribosomal subunit protein uL22 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8E2C7 3.23e-34 117 56 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7T4 3.23e-34 117 56 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3W4 3.23e-34 117 56 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8ETX7 3.28e-34 117 54 0 110 3 rplV Large ribosomal subunit protein uL22 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6XYY1 3.63e-34 117 57 0 109 3 rplV Large ribosomal subunit protein uL22 Spiroplasma kunkelii
Q7A079 4.39e-34 117 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain MW2)
Q6G776 4.39e-34 117 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain MSSA476)
Q6GEI8 4.39e-34 117 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain MRSA252)
Q7A460 4.39e-34 117 54 0 109 1 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain N315)
Q99S26 4.39e-34 117 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ87 4.39e-34 117 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain Newman)
Q5HDW3 4.39e-34 117 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain COL)
Q2YYQ1 4.39e-34 117 54 0 109 1 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV29 4.39e-34 117 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain JH9)
Q2FW11 4.39e-34 117 54 0 109 1 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEP4 4.39e-34 117 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain USA300)
A6U3X0 4.39e-34 117 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain JH1)
A7X5F6 4.39e-34 117 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus aureus (strain Mu3 / ATCC 700698)
C4XLX8 4.55e-34 116 55 0 109 3 rplV Large ribosomal subunit protein uL22 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B1I1J3 5.19e-34 116 56 0 109 3 rplV Large ribosomal subunit protein uL22 Desulforudis audaxviator (strain MP104C)
Q5L418 5.54e-34 116 52 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacillus kaustophilus (strain HTA426)
B0TC61 6.19e-34 117 58 0 105 3 rplV Large ribosomal subunit protein uL22 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q034Y8 6.3e-34 116 54 0 106 3 rplV Large ribosomal subunit protein uL22 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAL2 6.3e-34 116 54 0 106 3 rplV Large ribosomal subunit protein uL22 Lacticaseibacillus casei (strain BL23)
Q38UR7 6.51e-34 116 59 0 100 3 rplV Large ribosomal subunit protein uL22 Latilactobacillus sakei subsp. sakei (strain 23K)
B0SSH2 6.73e-34 116 55 1 110 3 rplV Large ribosomal subunit protein uL22 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SA42 6.75e-34 116 55 1 110 3 rplV Large ribosomal subunit protein uL22 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A0LIJ5 7.04e-34 116 52 0 110 3 rplV Large ribosomal subunit protein uL22 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q4L8A9 7.42e-34 116 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus haemolyticus (strain JCSC1435)
Q8CRG5 7.42e-34 116 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM04 7.42e-34 116 54 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q03PW2 9.41e-34 116 57 0 106 3 rplV Large ribosomal subunit protein uL22 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q65PA2 1.11e-33 115 54 0 106 3 rplV Large ribosomal subunit protein uL22 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8DS19 1.19e-33 115 55 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q6AP66 1.6e-33 115 54 0 109 3 rplV Large ribosomal subunit protein uL22 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
P48286 1.99e-33 115 54 0 110 1 rplV Large ribosomal subunit protein uL22 Thermus thermophilus
Q5SHP3 1.99e-33 115 54 0 110 1 rplV Large ribosomal subunit protein uL22 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72I09 1.99e-33 115 54 0 110 1 rplV Large ribosomal subunit protein uL22 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
C5D3S2 2.04e-33 115 52 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacillus sp. (strain WCH70)
Q3A9S1 2.48e-33 114 54 0 110 3 rplV Large ribosomal subunit protein uL22 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B8D0C9 2.74e-33 114 54 0 110 3 rplV Large ribosomal subunit protein uL22 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q88XY1 3.06e-33 114 55 0 106 3 rplV Large ribosomal subunit protein uL22 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P23311 3.44e-33 114 51 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacillus stearothermophilus
Q67JU8 3.6e-33 114 53 0 110 3 rplV Large ribosomal subunit protein uL22 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q30Z47 4.43e-33 114 49 0 109 3 rplV Large ribosomal subunit protein uL22 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A4XLS5 6.08e-33 114 54 0 106 3 rplV Large ribosomal subunit protein uL22 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q9Z9K9 1.76e-32 112 51 0 110 3 rplV Large ribosomal subunit protein uL22 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q1MPQ8 2.29e-32 112 50 0 109 3 rplV Large ribosomal subunit protein uL22 Lawsonia intracellularis (strain PHE/MN1-00)
A9KJI9 2.51e-32 112 52 0 102 3 rplV Large ribosomal subunit protein uL22 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q02W29 2.53e-32 112 55 0 106 3 rplV Large ribosomal subunit protein uL22 Lactococcus lactis subsp. cremoris (strain SK11)
A2RNQ0 2.53e-32 112 55 0 106 1 rplV Large ribosomal subunit protein uL22 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CDW7 2.53e-32 112 55 0 106 3 rplV Large ribosomal subunit protein uL22 Lactococcus lactis subsp. lactis (strain IL1403)
C1CP93 3.68e-32 112 55 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIA2 3.68e-32 112 55 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain P1031)
C1CC11 3.68e-32 112 55 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain JJA)
P61183 3.68e-32 112 55 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS45 3.68e-32 112 55 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain CGSP14)
P61182 3.68e-32 112 55 0 106 1 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKG2 3.68e-32 112 55 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8K3 3.68e-32 112 55 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAL7 3.68e-32 112 55 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae (strain 70585)
B5E6G0 3.68e-32 112 55 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae serotype 19F (strain G54)
Q04MN1 3.68e-32 112 55 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A8ZV62 3.72e-32 112 52 2 111 3 rplV Large ribosomal subunit protein uL22 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A7HM47 4.68e-32 112 52 0 110 3 rplV Large ribosomal subunit protein uL22 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q49ZG3 5.76e-32 111 52 0 109 3 rplV Large ribosomal subunit protein uL22 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q39Y01 5.91e-32 111 50 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q04C10 6.35e-32 111 54 0 102 3 rplV Large ribosomal subunit protein uL22 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBL3 6.35e-32 111 54 0 102 3 rplV Large ribosomal subunit protein uL22 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A4VSF9 9.32e-32 110 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus suis (strain 05ZYH33)
A4VYP8 9.32e-32 110 54 0 106 3 rplV Large ribosomal subunit protein uL22 Streptococcus suis (strain 98HAH33)
A6W5U3 1.17e-31 111 51 1 113 3 rplV Large ribosomal subunit protein uL22 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
A6LLL8 1.22e-31 111 51 0 110 3 rplV Large ribosomal subunit protein uL22 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B2G8X3 1.25e-31 110 56 0 106 3 rplV Large ribosomal subunit protein uL22 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLK0 1.25e-31 110 56 0 106 3 rplV Large ribosomal subunit protein uL22 Limosilactobacillus reuteri (strain DSM 20016)
Q5WLQ7 1.31e-31 110 51 0 106 3 rplV Large ribosomal subunit protein uL22 Shouchella clausii (strain KSM-K16)
B8G6S0 1.4e-31 110 51 0 110 3 rplV Large ribosomal subunit protein uL22 Chloroflexus aggregans (strain MD-66 / DSM 9485)
A6LPR6 1.43e-31 110 50 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q6F1Y9 1.47e-31 110 55 0 109 3 rplV Large ribosomal subunit protein uL22 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q2RFQ2 2.13e-31 110 53 0 110 3 rplV Large ribosomal subunit protein uL22 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
C4ZBS4 2.14e-31 110 54 1 105 3 rplV Large ribosomal subunit protein uL22 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q748Z3 3.07e-31 109 51 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q74L84 4.07e-31 109 54 0 103 3 rplV Large ribosomal subunit protein uL22 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q046C0 4.07e-31 109 54 0 103 3 rplV Large ribosomal subunit protein uL22 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
B9LJD7 4.28e-31 109 51 0 110 3 rplV Large ribosomal subunit protein uL22 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WH71 4.28e-31 109 51 0 110 3 rplV Large ribosomal subunit protein uL22 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q97EI3 4.6e-31 108 50 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B0RZU5 5.46e-31 108 50 0 110 3 rplV Large ribosomal subunit protein uL22 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A8YXL0 5.72e-31 108 54 0 103 3 rplV Large ribosomal subunit protein uL22 Lactobacillus helveticus (strain DPC 4571)
Q98PY6 7.47e-31 108 48 0 110 3 rplV Large ribosomal subunit protein uL22 Mycoplasmopsis pulmonis (strain UAB CTIP)
B7IHV1 8.83e-31 109 52 0 109 3 rplV Large ribosomal subunit protein uL22 Thermosipho africanus (strain TCF52B)
Q47LJ8 9.05e-31 108 53 0 110 3 rplV Large ribosomal subunit protein uL22 Thermobifida fusca (strain YX)
C5C0I6 9.3e-31 108 50 2 115 3 rplV Large ribosomal subunit protein uL22 Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q5FM85 9.77e-31 108 54 0 103 3 rplV Large ribosomal subunit protein uL22 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q6KI50 9.82e-31 108 50 0 110 3 rplV Large ribosomal subunit protein uL22 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
A4FPM0 9.83e-31 108 52 0 107 3 rplV Large ribosomal subunit protein uL22 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q1XDH9 1.04e-30 108 51 0 108 3 rpl22 Large ribosomal subunit protein uL22c Neopyropia yezoensis
Q18CG1 1.17e-30 108 50 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridioides difficile (strain 630)
B3PMP2 1.37e-30 110 54 0 106 3 rplV Large ribosomal subunit protein uL22 Metamycoplasma arthritidis (strain 158L3-1)
Q890P2 1.45e-30 107 50 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridium tetani (strain Massachusetts / E88)
A7NR58 1.5e-30 107 53 0 109 3 rplV Large ribosomal subunit protein uL22 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q9L0D5 1.52e-30 107 53 1 111 3 rplV Large ribosomal subunit protein uL22 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q82DP0 1.52e-30 107 53 1 111 3 rplV Large ribosomal subunit protein uL22 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A5USI4 1.75e-30 107 53 0 109 3 rplV Large ribosomal subunit protein uL22 Roseiflexus sp. (strain RS-1)
B8IYH7 2.12e-30 107 47 0 109 3 rplV Large ribosomal subunit protein uL22 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
A5N4Q2 2.42e-30 107 47 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYB4 2.42e-30 107 47 0 110 3 rplV Large ribosomal subunit protein uL22 Clostridium kluyveri (strain NBRC 12016)
A8LC51 3.25e-30 107 52 0 106 3 rplV Large ribosomal subunit protein uL22 Parafrankia sp. (strain EAN1pec)
Q1QN25 5.13e-30 107 54 0 106 3 rplV Large ribosomal subunit protein uL22 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
P51309 5.27e-30 106 50 0 108 3 rpl22 Large ribosomal subunit protein uL22c Porphyra purpurea
O31160 7.28e-30 106 55 0 109 3 rplV Large ribosomal subunit protein uL22 Spiroplasma citri
B9M6H3 8.07e-30 105 49 0 110 3 rplV Large ribosomal subunit protein uL22 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A9NED8 8.8e-30 105 50 0 110 3 rplV Large ribosomal subunit protein uL22 Acholeplasma laidlawii (strain PG-8A)
A9WSV4 9.84e-30 105 53 2 113 3 rplV Large ribosomal subunit protein uL22 Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
C6E4Q2 1.07e-29 105 49 0 110 3 rplV Large ribosomal subunit protein uL22 Geobacter sp. (strain M21)
B5EFQ5 1.07e-29 105 49 0 110 3 rplV Large ribosomal subunit protein uL22 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B8FET0 1.15e-29 105 49 1 109 3 rplV Large ribosomal subunit protein uL22 Desulfatibacillum aliphaticivorans
B1W402 1.19e-29 105 52 1 111 3 rplV Large ribosomal subunit protein uL22 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B2A4E4 1.21e-29 105 49 0 110 3 rplV Large ribosomal subunit protein uL22 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B2GDW4 1.23e-29 105 53 0 106 3 rplV Large ribosomal subunit protein uL22 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q2LQ96 1.27e-29 105 52 0 110 3 rplV Large ribosomal subunit protein uL22 Syntrophus aciditrophicus (strain SB)
B3E7U0 1.28e-29 105 52 0 109 3 rplV Large ribosomal subunit protein uL22 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A1ALU6 1.38e-29 105 49 0 109 3 rplV Large ribosomal subunit protein uL22 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A1R8U0 1.38e-29 105 52 2 113 3 rplV Large ribosomal subunit protein uL22 Paenarthrobacter aurescens (strain TC1)
A1SNL3 1.6e-29 106 53 0 104 3 rplV Large ribosomal subunit protein uL22 Nocardioides sp. (strain ATCC BAA-499 / JS614)
P10139 1.95e-29 105 53 0 109 3 rplV Large ribosomal subunit protein uL22 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q3SSW1 2.12e-29 105 53 0 106 3 rplV Large ribosomal subunit protein uL22 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
C5CC57 2.57e-29 105 48 1 115 3 rplV Large ribosomal subunit protein uL22 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Q2JV86 3e-29 104 50 0 106 3 rplV Large ribosomal subunit protein uL22 Synechococcus sp. (strain JA-3-3Ab)
Q6A6N1 3.35e-29 105 50 0 108 1 rplV Large ribosomal subunit protein uL22 Cutibacterium acnes (strain DSM 16379 / KPA171202)
A6TWH7 4.13e-29 103 48 0 110 3 rplV Large ribosomal subunit protein uL22 Alkaliphilus metalliredigens (strain QYMF)
B9KZY2 4.31e-29 104 49 0 109 3 rplV Large ribosomal subunit protein uL22 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Q3ZZL9 4.42e-29 103 49 0 109 3 rplV Large ribosomal subunit protein uL22 Dehalococcoides mccartyi (strain CBDB1)
A5FRY0 4.42e-29 103 49 0 109 3 rplV Large ribosomal subunit protein uL22 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A1VEB1 5.68e-29 103 47 0 109 3 rplV Large ribosomal subunit protein uL22 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CH5 5.68e-29 103 47 0 109 3 rplV Large ribosomal subunit protein uL22 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q4G360 6.07e-29 103 50 0 108 3 rpl22 Large ribosomal subunit protein uL22c Emiliania huxleyi
A5GAX0 6.09e-29 103 48 0 110 3 rplV Large ribosomal subunit protein uL22 Geotalea uraniireducens (strain Rf4)
A5IYY1 7.32e-29 103 53 0 100 3 rplV Large ribosomal subunit protein uL22 Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
B8DNA1 7.88e-29 103 47 0 109 3 rplV Large ribosomal subunit protein uL22 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B2IK67 9.1e-29 103 54 0 108 3 rplV Large ribosomal subunit protein uL22 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
P73315 9.23e-29 103 51 0 107 3 rplV Large ribosomal subunit protein uL22 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A0JZ79 9.23e-29 103 51 2 113 3 rplV Large ribosomal subunit protein uL22 Arthrobacter sp. (strain FB24)
Q3Z976 1.13e-28 102 48 0 109 3 rplV Large ribosomal subunit protein uL22 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
B2GIZ8 1.44e-28 103 51 2 113 3 rplV Large ribosomal subunit protein uL22 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
B0JHZ8 1.89e-28 102 51 0 107 3 rplV Large ribosomal subunit protein uL22 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
A8M524 2.14e-28 103 53 0 100 3 rplV Large ribosomal subunit protein uL22 Salinispora arenicola (strain CNS-205)
A4XBP1 2.21e-28 103 53 0 100 3 rplV Large ribosomal subunit protein uL22 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q6MSN0 2.21e-28 102 52 0 109 3 rplV Large ribosomal subunit protein uL22 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
A9BHA0 2.45e-28 103 46 0 110 3 rplV Large ribosomal subunit protein uL22 Petrotoga mobilis (strain DSM 10674 / SJ95)
B1XJT4 2.77e-28 102 52 0 107 3 rplV Large ribosomal subunit protein uL22 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q2JIM2 3.13e-28 102 50 0 106 3 rplV Large ribosomal subunit protein uL22 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q1AU34 3.29e-28 102 55 0 101 3 rplV Large ribosomal subunit protein uL22 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
B8ELF8 3.73e-28 102 51 0 108 3 rplV Large ribosomal subunit protein uL22 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q8GM55 4.67e-28 102 51 0 102 3 rplV Large ribosomal subunit protein uL22 Metamycoplasma hominis (strain ATCC 23114 / DSM 25592 / NBRC 14850 / NCTC 10111 / PG21)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18945
Feature type CDS
Gene rplV
Product 50S ribosomal protein L22
Location 9951 - 10283 (strand: 1)
Length 333 (nucleotides) / 110 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000011
Length 30728 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2427
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00237 Ribosomal protein L22p/L17e

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0091 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L22

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02890 large subunit ribosomal protein L22 Ribosome -

Protein Sequence

METIAMHRHARSSAQKVRLVADLIRGKKVSQALEILAFTNKKAAGLVKKVLESAIANAEHNDGADIDDLKVAKIFVDDGPTMKRIMPRAKGRADRILKRTSHITVVVSDR

Flanking regions ( +/- flanking 50bp)

GGCCATGTGGCTGATAAAAAAGCCAAAAAGAAATAAGGTAGGAGGAAGAGATGGAAACTATTGCTATGCATCGCCACGCTCGTTCTTCTGCTCAGAAGGTTCGCCTGGTGGCTGACCTGATCCGCGGTAAGAAAGTGTCGCAAGCTCTGGAAATTTTAGCTTTTACCAACAAGAAAGCTGCTGGTTTAGTTAAGAAAGTCCTGGAGTCTGCTATTGCTAACGCAGAACACAACGATGGCGCTGACATCGATGATCTGAAAGTAGCGAAGATTTTCGTTGACGACGGCCCAACCATGAAGCGCATCATGCCTCGTGCAAAAGGTCGTGCAGATCGTATTCTTAAGCGCACCAGCCACATTACTGTGGTTGTGTCCGATCGCTGAGACTCTGGAGACTAGCAATGGGTCAGAAAGTACATCCAAATGGTATTCGC