Homologs in group_2435

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19260 FBDBKF_19260 47.6 Morganella morganii S1 bfd bacterioferritin-associated ferredoxin
EHELCC_19005 EHELCC_19005 47.6 Morganella morganii S2 bfd bacterioferritin-associated ferredoxin
NLDBIP_19020 NLDBIP_19020 47.6 Morganella morganii S4 bfd bacterioferritin-associated ferredoxin
LHKJJB_18875 LHKJJB_18875 47.6 Morganella morganii S3 bfd bacterioferritin-associated ferredoxin
HKOGLL_18610 HKOGLL_18610 47.6 Morganella morganii S5 bfd bacterioferritin-associated ferredoxin
F4V73_RS18905 F4V73_RS18905 46.0 Morganella psychrotolerans bfd bacterioferritin-associated ferredoxin

Distribution of the homologs in the orthogroup group_2435

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2435

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1Z6 8.71e-17 69 49 1 65 3 bfd Bacterioferritin-associated ferredoxin Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1Z7 8.71e-17 69 49 1 65 3 bfd Bacterioferritin-associated ferredoxin Salmonella typhi
O68934 2.81e-16 68 50 1 65 3 bfd Bacterioferritin-associated ferredoxin Serratia marcescens
P0AE56 3.47e-16 68 47 1 65 1 bfd Bacterioferritin-associated ferredoxin Escherichia coli (strain K12)
P0AE57 3.47e-16 68 47 1 65 3 bfd Bacterioferritin-associated ferredoxin Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9HY80 7.01e-05 39 38 1 50 1 bfd Bacterioferritin-associated ferredoxin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16135
Feature type CDS
Gene bfd
Product bacterioferritin-associated ferredoxin
Location 3581274 - 3581471 (strand: 1)
Length 198 (nucleotides) / 65 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2435
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04324 BFD-like [2Fe-2S] binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2906 Inorganic ion transport and metabolism (P) P Bacterioferritin-associated ferredoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02192 bacterioferritin-associated ferredoxin - -

Protein Sequence

MYVCLCHGVSDKKIISTVHKHKIRTINQLRQILPVGSCCGKCIRQARQLIDDEQHLLYPQISEVA

Flanking regions ( +/- flanking 50bp)

ACAATGATTATCATTTACTATCTTGATAGGTAGTTAATGAGGTCGTTATTATGTATGTCTGTCTGTGTCATGGTGTGAGTGATAAAAAAATTATCTCTACTGTTCATAAACATAAAATTCGAACAATCAATCAATTGCGTCAAATCCTACCTGTAGGCAGTTGTTGTGGTAAATGTATACGTCAAGCTCGTCAACTTATAGATGATGAACAACACCTCCTTTATCCTCAAATTTCTGAAGTTGCATAACAGTTTTTAATATTCCTTTCTCTCTACTTTGTATAAAAGGTCTACACTAA