Homologs in group_323

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09615 FBDBKF_09615 31.3 Morganella morganii S1 bioF 8-amino-7-oxononanoate synthase
EHELCC_04415 EHELCC_04415 31.3 Morganella morganii S2 bioF 8-amino-7-oxononanoate synthase
NLDBIP_04415 NLDBIP_04415 31.3 Morganella morganii S4 bioF 8-amino-7-oxononanoate synthase
LHKJJB_14215 LHKJJB_14215 31.3 Morganella morganii S3 bioF 8-amino-7-oxononanoate synthase
HKOGLL_12320 HKOGLL_12320 31.3 Morganella morganii S5 bioF 8-amino-7-oxononanoate synthase
F4V73_RS00725 F4V73_RS00725 31.9 Morganella psychrotolerans bioF 8-amino-7-oxononanoate synthase
PMI_RS02975 PMI_RS02975 32.6 Proteus mirabilis HI4320 bioF 8-amino-7-oxononanoate synthase

Distribution of the homologs in the orthogroup group_323

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_323

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AB79 0.0 676 81 0 394 3 kbl 2-amino-3-ketobutyrate coenzyme A ligase Shigella flexneri
P0AB77 0.0 676 81 0 394 1 kbl 2-amino-3-ketobutyrate coenzyme A ligase Escherichia coli (strain K12)
P0AB78 0.0 676 81 0 394 3 kbl 2-amino-3-ketobutyrate coenzyme A ligase Escherichia coli O157:H7
P37419 0.0 674 81 0 394 3 kbl 2-amino-3-ketobutyrate coenzyme A ligase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O88986 3.88e-151 436 55 3 386 1 Gcat 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial Mus musculus
Q0P5L8 1.35e-150 435 56 3 386 1 GCAT 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial Bos taurus
O75600 1.57e-148 430 55 3 386 1 GCAT 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial Homo sapiens
A7HMM1 9.51e-116 345 46 4 394 3 Fnod_1307 8-amino-7-oxononanoate synthase Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
A9BGL0 2.15e-115 345 44 2 393 3 Pmob_1549 8-amino-7-oxononanoate synthase Petrotoga mobilis (strain DSM 10674 / SJ95)
B0KC20 7.18e-115 343 43 3 389 3 Teth39_0287 8-amino-7-oxononanoate synthase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B7ID58 7.26e-115 343 44 3 392 3 bioF 8-amino-7-oxononanoate synthase Thermosipho africanus (strain TCF52B)
B0K590 7.92e-115 343 43 3 389 3 bioF 8-amino-7-oxononanoate synthase Thermoanaerobacter sp. (strain X514)
A6LMP4 8.19e-115 343 44 3 392 3 bioF 8-amino-7-oxononanoate synthase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B5EEV8 5.32e-110 331 44 6 393 3 bioF 8-amino-7-oxononanoate synthase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B5Y9Z4 2.53e-108 327 44 4 398 3 COPRO5265_1289 8-amino-7-oxononanoate synthase Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
B9M8U3 1.39e-107 325 43 4 392 3 bioF 8-amino-7-oxononanoate synthase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q6GJB8 2.5e-107 324 41 4 396 3 SAR0555 Putative pyridoxal phosphate-dependent acyltransferase Staphylococcus aureus (strain MRSA252)
Q5HIC5 3.53e-107 324 41 4 396 3 SACOL0596 Putative pyridoxal phosphate-dependent acyltransferase Staphylococcus aureus (strain COL)
Q8NXY3 6.63e-107 323 41 4 396 3 MW0505 Putative pyridoxal phosphate-dependent acyltransferase Staphylococcus aureus (strain MW2)
Q6GBT7 6.63e-107 323 41 4 396 3 SAS0508 Putative pyridoxal phosphate-dependent acyltransferase Staphylococcus aureus (strain MSSA476)
P60120 6.63e-107 323 41 4 396 1 SA0508 Putative pyridoxal phosphate-dependent acyltransferase Staphylococcus aureus (strain N315)
P60121 6.63e-107 323 41 4 396 3 SAV0550 Putative pyridoxal phosphate-dependent acyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q749W3 3.56e-105 318 44 4 393 3 bioF 8-amino-7-oxononanoate synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8EM07 6.8e-105 318 40 4 399 3 OB3054 Putative pyridoxal phosphate-dependent acyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A6TU88 7.98e-104 315 40 3 391 3 Amet_3634 8-amino-7-oxononanoate synthase Alkaliphilus metalliredigens (strain QYMF)
B1YMC6 5.59e-103 313 41 3 392 3 Exig_1033 8-amino-7-oxononanoate synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A8FDG9 4.47e-102 310 41 3 392 3 BPUM_1604 8-amino-7-oxononanoate synthase Bacillus pumilus (strain SAFR-032)
Q67N86 6.19e-102 310 41 3 387 3 STH1872 8-amino-7-oxononanoate synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A5G6I9 2.35e-101 309 41 4 393 3 bioF 8-amino-7-oxononanoate synthase Geotalea uraniireducens (strain Rf4)
A7Z4X1 4.65e-101 308 40 3 392 3 RBAM_016840 8-amino-7-oxononanoate synthase 1 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q73KM3 4.68e-101 308 40 3 389 3 TDE_2194 8-amino-7-oxononanoate synthase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
A8MEX7 2.06e-100 306 39 3 389 3 Clos_0909 8-amino-7-oxononanoate synthase Alkaliphilus oremlandii (strain OhILAs)
B3EAE0 1.7e-99 304 43 4 393 3 bioF 8-amino-7-oxononanoate synthase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q39XE0 1.33e-98 301 41 4 393 3 bioF 8-amino-7-oxononanoate synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
O31777 2.18e-98 301 39 3 392 3 kbl 8-amino-7-oxononanoate synthase 1 Bacillus subtilis (strain 168)
Q81I05 2.37e-94 291 39 4 399 3 BC_0621 Putative pyridoxal phosphate-dependent acyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81V80 5.39e-94 290 39 4 399 3 BA_0620 Putative pyridoxal phosphate-dependent acyltransferase Bacillus anthracis
A1AQT1 3.35e-92 285 39 4 393 3 bioF 8-amino-7-oxononanoate synthase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
P22806 5.12e-90 280 37 3 390 1 bioF 8-amino-7-oxononanoate synthase Lysinibacillus sphaericus
Q5SHZ8 2.34e-89 278 38 4 391 1 TTHA1582 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A7BFV7 1.75e-86 271 35 3 384 1 spt Serine palmitoyltransferase Sphingobacterium spiritivorum
A1U4B1 1.34e-84 266 38 4 380 3 bioF 8-amino-7-oxononanoate synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A7BFV6 1.94e-83 263 35 4 399 1 spt Serine palmitoyltransferase Sphingobacterium multivorum
Q3A3Z8 3.03e-83 262 37 3 383 3 bioF Putative 8-amino-7-oxononanoate synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A4VR87 3.81e-83 262 38 4 380 3 bioF 8-amino-7-oxononanoate synthase Stutzerimonas stutzeri (strain A1501)
Q31E54 1.06e-82 261 38 5 389 3 bioF 8-amino-7-oxononanoate synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3J9D6 2.55e-81 257 36 4 380 3 bioF 8-amino-7-oxononanoate synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A3DBD5 5.67e-80 254 34 3 386 3 bioF Putative 8-amino-7-oxononanoate synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q02TR5 1.08e-79 253 36 4 388 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V486 1.08e-79 253 36 4 388 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas aeruginosa (strain LESB58)
Q9I617 1.1e-79 253 36 4 388 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q65ML1 3.19e-79 251 37 4 391 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q1I3N7 1.01e-78 251 37 4 376 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas entomophila (strain L48)
A6UYW1 2.34e-78 250 36 4 388 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas aeruginosa (strain PA7)
P53556 3.64e-78 249 37 4 389 1 bioF 8-amino-7-oxononanoate synthase 2 Bacillus subtilis (strain 168)
B0KJ54 4.07e-77 246 36 6 382 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas putida (strain GB-1)
Q4ZMA9 4.63e-77 246 36 4 374 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas syringae pv. syringae (strain B728a)
A7Z5B4 5.01e-77 246 37 4 385 3 bioF Putative 8-amino-7-oxononanoate synthase 2 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q5NZF5 9.05e-77 245 37 2 372 3 bioF 8-amino-7-oxononanoate synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q88A97 2.18e-76 245 36 4 380 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A4XZR8 3.25e-76 244 37 4 357 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas mendocina (strain ymp)
Q48CS2 8.7e-76 243 35 4 380 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1JE54 1.64e-75 242 36 6 382 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas putida (strain W619)
A7GSE1 7.48e-75 241 32 4 390 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A6W0Y0 1.26e-74 240 35 7 398 3 bioF 8-amino-7-oxononanoate synthase Marinomonas sp. (strain MWYL1)
Q0A5W2 1.7e-74 239 34 5 396 3 bioF 8-amino-7-oxononanoate synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A4G5N9 4.37e-74 238 36 6 386 3 bioF 8-amino-7-oxononanoate synthase Herminiimonas arsenicoxydans
Q88QX1 4.68e-74 238 36 6 382 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A7LXM2 5.53e-74 238 33 3 378 3 spt Serine palmitoyltransferase Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153)
Q4K4T3 5.57e-74 238 35 4 376 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A7BFV8 7.98e-74 239 33 3 389 1 spt Serine palmitoyltransferase Bacteriovorax stolpii
B7GHW7 1.19e-73 238 32 3 394 3 bioF Putative 8-amino-7-oxononanoate synthase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q8A9E5 3.78e-72 234 34 3 378 1 spt Serine palmitoyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q3K5P2 3.81e-72 234 36 4 364 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas fluorescens (strain Pf0-1)
Q8KZM9 1.9e-71 231 36 5 389 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus subtilis subsp. natto
Q0AE73 3.19e-71 231 36 5 382 3 bioF 8-amino-7-oxononanoate synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B8GTH6 6.53e-71 230 36 6 383 3 bioF 8-amino-7-oxononanoate synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q1DCV8 8.66e-71 230 36 6 383 3 bioF 8-amino-7-oxononanoate synthase Myxococcus xanthus (strain DK1622)
Q2SBD5 1.01e-70 230 34 4 394 3 bioF 8-amino-7-oxononanoate synthase Hahella chejuensis (strain KCTC 2396)
Q731H9 1.03e-70 230 32 4 391 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
P43090 1.56e-70 235 34 7 397 2 alas2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Opsanus tau
Q2Y9Y8 1.66e-70 229 33 3 395 3 bioF 8-amino-7-oxononanoate synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A9VG56 2.89e-70 229 32 4 390 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus mycoides (strain KBAB4)
Q21FY4 1.38e-69 227 32 5 394 3 bioF 8-amino-7-oxononanoate synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q9XT75 2.5e-69 231 35 7 363 2 ALAS2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Delphinapterus leucas
Q47C04 3.06e-69 226 35 6 388 3 bioF 8-amino-7-oxononanoate synthase Dechloromonas aromatica (strain RCB)
A5VXF2 4.02e-69 226 37 6 382 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q63147 6.06e-69 231 36 7 373 1 Alas2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Rattus norvegicus
B4ESU4 1.13e-68 224 32 3 372 3 bioF 8-amino-7-oxononanoate synthase Proteus mirabilis (strain HI4320)
Q3ZC31 1.76e-68 229 35 7 363 2 ALAS2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Bos taurus
B7IWN1 2.2e-68 224 32 4 391 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain G9842)
Q5R557 2.28e-68 229 35 7 363 2 ALAS2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Pongo abelii
B1I4F9 5.4e-68 223 35 4 373 3 bioF Putative 8-amino-7-oxononanoate synthase Desulforudis audaxviator (strain MP104C)
P22557 5.47e-68 228 35 7 363 1 ALAS2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Homo sapiens
P08680 7.74e-68 228 36 7 363 1 Alas2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Mus musculus
Q635G4 8.83e-68 223 32 4 387 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain ZK / E33L)
Q5W264 9.96e-68 229 36 5 366 1 pigH 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH Serratia sp. (strain ATCC 39006)
Q81ZZ4 1.32e-67 222 33 4 382 3 bioF 8-amino-7-oxononanoate synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B9IWY0 1.44e-67 222 31 3 390 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain Q1)
B7HNN4 1.44e-67 222 31 3 390 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain AH187)
Q609V1 2e-67 221 37 4 361 3 bioF 8-amino-7-oxononanoate synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0VMD1 2.06e-67 221 34 3 381 3 bioF 8-amino-7-oxononanoate synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A4SPR6 2.18e-67 221 36 6 350 3 bioF 8-amino-7-oxononanoate synthase Aeromonas salmonicida (strain A449)
P26505 3.16e-67 221 35 6 375 3 hemA 5-aminolevulinate synthase Rhizobium radiobacter
Q818X0 3.43e-67 221 32 4 383 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HAZ0 3.43e-67 221 32 4 383 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain B4264)
Q6HE48 5.55e-67 220 32 4 387 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
A7HG96 8.7e-67 220 36 3 382 3 bioF 8-amino-7-oxononanoate synthase Anaeromyxobacter sp. (strain Fw109-5)
B7JLX2 1.94e-66 219 32 4 387 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain AH820)
Q81MB0 1.94e-66 219 32 4 387 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus anthracis
A6SU64 4.98e-66 218 35 5 391 3 bioF 8-amino-7-oxononanoate synthase Janthinobacterium sp. (strain Marseille)
B7KD70 6.69e-66 217 34 6 384 3 bioF Putative 8-amino-7-oxononanoate synthase Gloeothece citriformis (strain PCC 7424)
Q2IF62 7.52e-66 218 37 3 382 3 bioF 8-amino-7-oxononanoate synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
A0RIB9 8.28e-66 217 31 4 387 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus thuringiensis (strain Al Hakam)
A1K6Q1 8.87e-66 217 37 3 349 3 bioF 8-amino-7-oxononanoate synthase Azoarcus sp. (strain BH72)
B8J637 9.77e-66 217 36 3 382 3 bioF 8-amino-7-oxononanoate synthase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B4UCB1 1.06e-65 217 36 3 382 3 bioF 8-amino-7-oxononanoate synthase Anaeromyxobacter sp. (strain K)
A1VUJ6 1.48e-65 217 33 7 403 3 bioF 8-amino-7-oxononanoate synthase Polaromonas naphthalenivorans (strain CJ2)
A2SD53 1.78e-65 216 35 5 371 3 bioF 8-amino-7-oxononanoate synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B8J3V0 1.99e-65 216 35 5 382 3 bioF Putative 8-amino-7-oxononanoate synthase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q5KY23 3.09e-65 216 33 3 367 3 bioF Putative 8-amino-7-oxononanoate synthase Geobacillus kaustophilus (strain HTA426)
A0KIC7 4.59e-65 216 34 7 382 3 bioF 8-amino-7-oxononanoate synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q146K3 6.81e-65 215 38 5 360 1 bioF 8-amino-7-oxononanoate synthase Paraburkholderia xenovorans (strain LB400)
A6QLI6 7e-65 221 35 6 358 2 ALAS1 5-aminolevulinate synthase, non-specific, mitochondrial Bos taurus
Q9YHT4 1.66e-64 219 32 7 410 2 alas2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Danio rerio
B3PI88 2.78e-64 213 35 5 356 3 bioF 8-amino-7-oxononanoate synthase Cellvibrio japonicus (strain Ueda107)
Q04512 3.45e-64 213 36 5 354 3 hemA 5-aminolevulinate synthase 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P18079 4.49e-64 213 37 5 340 1 hemA 5-aminolevulinate synthase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O66875 6.22e-64 212 31 6 385 3 bioF Putative 8-amino-7-oxononanoate synthase Aquifex aeolicus (strain VF5)
B7K0L9 7.71e-64 212 31 5 382 3 bioF Putative 8-amino-7-oxononanoate synthase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q119K2 1.63e-63 211 32 5 393 3 bioF Putative 8-amino-7-oxononanoate synthase Trichodesmium erythraeum (strain IMS101)
P13195 2.4e-63 217 34 6 358 2 Alas1 5-aminolevulinate synthase, non-specific, mitochondrial Rattus norvegicus
Q06965 2.45e-63 211 33 6 399 3 hemT 5-aminolevulinate synthase 2 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B2SWS7 3e-63 211 37 4 360 3 bioF 8-amino-7-oxononanoate synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A9BV10 3.96e-63 211 34 5 362 3 bioF 8-amino-7-oxononanoate synthase Delftia acidovorans (strain DSM 14801 / SPH-1)
B2JKH6 4.22e-63 210 35 5 394 1 bioF 8-amino-7-oxononanoate synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
P08262 4.29e-63 211 35 4 356 3 hemA 5-aminolevulinate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q3BYN0 4.32e-63 211 36 4 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PDF1 4.91e-63 210 35 4 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UZN9 4.91e-63 210 35 4 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas campestris pv. campestris (strain 8004)
B0RMR1 5.52e-63 210 35 4 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas campestris pv. campestris (strain B100)
Q1QYD6 7.44e-63 209 31 3 380 3 bioF 8-amino-7-oxononanoate synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
P13196 9.62e-63 216 34 5 355 1 ALAS1 5-aminolevulinate synthase, non-specific, mitochondrial Homo sapiens
Q5R9R9 1.09e-62 215 34 5 355 2 ALAS1 5-aminolevulinate synthase, non-specific, mitochondrial Pongo abelii
Q9XS79 1.44e-62 215 34 6 358 2 ALAS1 5-aminolevulinate synthase, non-specific, mitochondrial Delphinapterus leucas
A7MJ02 1.76e-62 208 36 5 365 3 bioF 8-amino-7-oxononanoate synthase Cronobacter sakazakii (strain ATCC BAA-894)
Q1GZA7 1.83e-62 209 34 3 365 3 bioF 8-amino-7-oxononanoate synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q8VC19 2.84e-62 214 34 6 358 1 Alas1 5-aminolevulinate synthase, non-specific, mitochondrial Mus musculus
Q93UV0 2.95e-62 209 33 3 373 1 spt Serine palmitoyltransferase Sphingomonas paucimobilis
P43089 4.1e-62 208 34 6 397 3 hemA 5-aminolevulinate synthase Paracoccus denitrificans (strain Pd 1222)
P38092 5.99e-62 213 33 9 418 3 hemA 5-aminolevulinate synthase, mitochondrial Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B2J1W1 6.8e-62 207 34 5 383 3 bioF Putative 8-amino-7-oxononanoate synthase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q7N6Q6 7.24e-62 207 32 4 379 3 bioF 8-amino-7-oxononanoate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9K625 7.76e-62 207 32 3 386 3 bioF Putative 8-amino-7-oxononanoate synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P07997 8.14e-62 213 34 6 358 1 ALAS1 5-aminolevulinate synthase, non-specific, mitochondrial Gallus gallus
A0A0H3C7E9 8.35e-62 207 35 2 360 1 spt Serine palmitoyltransferase Caulobacter vibrioides (strain NA1000 / CB15N)
B7VH15 1.11e-61 207 33 6 377 3 bioF 8-amino-7-oxononanoate synthase Vibrio atlanticus (strain LGP32)
Q58694 1.28e-61 206 33 11 380 3 bioF Putative 8-amino-7-oxononanoate synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q92403 1.42e-61 212 34 8 372 2 hem1 5-aminolevulinate synthase, mitochondrial Agaricus bisporus
B0JQZ0 1.49e-61 206 33 5 376 3 bioF Putative 8-amino-7-oxononanoate synthase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
B0C205 1.53e-61 206 31 5 395 3 bioF Putative 8-amino-7-oxononanoate synthase Acaryochloris marina (strain MBIC 11017)
B1XL23 1.53e-61 206 33 6 384 3 bioF Putative 8-amino-7-oxononanoate synthase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q6BX71 2.42e-61 210 32 10 420 3 HEM1 5-aminolevulinate synthase, mitochondrial Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
A6UQL9 3.68e-61 204 32 8 372 3 bioF Putative 8-amino-7-oxononanoate synthase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q5DZH9 3.81e-61 205 32 8 395 3 bioF 8-amino-7-oxononanoate synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B1Y500 4.55e-61 205 33 6 410 3 bioF 8-amino-7-oxononanoate synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
P09950 6.2e-61 209 32 6 359 1 HEM1 5-aminolevulinate synthase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B3QLR6 6.93e-61 204 34 7 383 3 Cpar_2015 8-amino-7-oxononanoate synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B5ELF7 7.6e-61 204 37 4 342 3 bioF 8-amino-7-oxononanoate synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J3Y7 7.6e-61 204 37 4 342 3 bioF 8-amino-7-oxononanoate synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q7NNL4 7.64e-61 204 33 5 390 3 bioF Putative 8-amino-7-oxononanoate synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q6FXE3 9.92e-61 207 32 6 379 3 HEM1 5-aminolevulinate synthase, mitochondrial Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q3M9A4 1.5e-60 203 33 5 386 3 bioF Putative 8-amino-7-oxononanoate synthase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8PQD8 1.69e-60 204 36 4 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas axonopodis pv. citri (strain 306)
P43091 3.14e-60 208 34 6 368 2 alas1 5-aminolevulinate synthase, non-specific, mitochondrial Opsanus tau
Q5H5R0 5.91e-60 202 36 4 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SS66 5.91e-60 202 36 4 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P8F2 5.91e-60 202 36 4 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q0APZ9 1.06e-59 201 38 6 344 3 bioF 8-amino-7-oxononanoate synthase Maricaulis maris (strain MCS10)
O94069 1.4e-59 206 30 8 411 3 HEM1 5-aminolevulinate synthase, mitochondrial Candida albicans (strain SC5314 / ATCC MYA-2876)
Q6LPR3 1.48e-59 201 31 7 386 3 bioF 8-amino-7-oxononanoate synthase Photobacterium profundum (strain SS9)
Q2NUJ6 1.52e-59 201 34 5 384 3 bioF 8-amino-7-oxononanoate synthase Sodalis glossinidius (strain morsitans)
Q7MLU9 1.63e-59 201 33 5 379 3 bioF 8-amino-7-oxononanoate synthase Vibrio vulnificus (strain YJ016)
A7HP29 2.16e-59 201 34 3 361 3 bioF Putative 8-amino-7-oxononanoate synthase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B5EUP9 2.58e-59 200 31 8 395 3 bioF 8-amino-7-oxononanoate synthase Aliivibrio fischeri (strain MJ11)
B0U6J0 6.72e-59 199 35 6 354 3 bioF 8-amino-7-oxononanoate synthase Xylella fastidiosa (strain M12)
B5YFU5 6.79e-59 199 30 6 382 3 bioF Putative 8-amino-7-oxononanoate synthase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q87DT2 7.88e-59 199 35 6 354 3 bioF 8-amino-7-oxononanoate synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9H7 7.88e-59 199 35 6 354 3 bioF 8-amino-7-oxononanoate synthase Xylella fastidiosa (strain M23)
Q1REF4 1.18e-58 198 36 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain UTI89 / UPEC)
A1A918 1.18e-58 198 36 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O1:K1 / APEC
B7MGN4 1.18e-58 198 36 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3Z408 1.22e-58 198 33 6 383 3 bioF 8-amino-7-oxononanoate synthase Shigella sonnei (strain Ss046)
B2AG98 1.84e-58 198 34 7 397 3 bioF 8-amino-7-oxononanoate synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q83S45 1.91e-58 198 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Shigella flexneri
Q0T6I4 1.91e-58 198 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Shigella flexneri serotype 5b (strain 8401)
B7NNK6 2.06e-58 198 36 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8D8N0 2.27e-58 197 32 5 379 3 bioF 8-amino-7-oxononanoate synthase Vibrio vulnificus (strain CMCP6)
A6UWX3 2.79e-58 197 34 7 335 3 bioF Putative 8-amino-7-oxononanoate synthase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
B7M748 3.39e-58 197 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O8 (strain IAI1)
B5YRL5 5.46e-58 197 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X823 5.46e-58 197 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O157:H7
Q8DJ97 5.93e-58 197 35 5 364 3 bioF Putative 8-amino-7-oxononanoate synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B1LM67 6.07e-58 196 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain SMS-3-5 / SECEC)
P78698 6.64e-58 201 32 7 353 3 HEM1 5-aminolevulinate synthase, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
A8ZUS7 8.75e-58 196 31 4 379 3 bioF Putative 8-amino-7-oxononanoate synthase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A8GBC6 8.77e-58 196 35 5 381 3 bioF 8-amino-7-oxononanoate synthase Serratia proteamaculans (strain 568)
B7LC58 9.38e-58 196 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain 55989 / EAEC)
Q8FJQ2 9.79e-58 196 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B2VBT8 1.48e-57 196 33 5 384 3 bioF 8-amino-7-oxononanoate synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q47829 1.55e-57 196 32 6 391 3 bioF 8-amino-7-oxononanoate synthase Pseudescherichia vulneris
P12998 1.76e-57 195 35 5 349 1 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain K12)
B1X7A6 1.76e-57 195 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain K12 / DH10B)
B6I7T0 2.34e-57 195 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain SE11)
A7ZJI5 2.34e-57 195 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0KF88 3.25e-57 195 33 7 397 3 bioF 8-amino-7-oxononanoate synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0TJS2 3.57e-57 194 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MQM9 3.57e-57 194 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O81 (strain ED1a)
Q32I45 4.06e-57 194 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Shigella dysenteriae serotype 1 (strain Sd197)
A9HJ57 5.13e-57 194 34 4 355 3 GDI1920 8-amino-7-oxononanoate synthase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A5FZN8 6.26e-57 194 37 5 343 3 bioF Putative 8-amino-7-oxononanoate synthase Acidiphilium cryptum (strain JF-5)
Q89AK6 7.2e-57 194 31 4 387 3 bioF 8-amino-7-oxononanoate synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B1IXJ2 9.09e-57 193 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZY32 9.09e-57 193 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O9:H4 (strain HS)
B8HTV6 9.42e-57 194 32 6 391 3 bioF Putative 8-amino-7-oxononanoate synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q9PDM2 1.04e-56 194 35 6 354 3 bioF 8-amino-7-oxononanoate synthase Xylella fastidiosa (strain 9a5c)
B2IH50 1.16e-56 193 34 6 367 3 Bind_0814 8-amino-7-oxononanoate synthase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q6CCW0 1.3e-56 197 31 7 412 3 HEM1 5-aminolevulinate synthase, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
B7ULX3 1.53e-56 193 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q324B6 2.6e-56 192 34 5 349 3 bioF 8-amino-7-oxononanoate synthase Shigella boydii serotype 4 (strain Sb227)
B2TVF4 2.6e-56 192 34 5 349 3 bioF 8-amino-7-oxononanoate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q6D3C0 2.87e-56 192 30 5 393 3 bioF 8-amino-7-oxononanoate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MX30 2.87e-56 192 33 8 379 3 bioF 8-amino-7-oxononanoate synthase Vibrio campbellii (strain ATCC BAA-1116)
P9WQ85 4.08e-56 200 32 3 398 1 bioF2 Putative 8-amino-7-oxononanoate synthase 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ84 4.08e-56 200 32 3 398 3 bioF2 Putative 8-amino-7-oxononanoate synthase 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q87QN5 5.91e-56 191 32 7 379 3 bioF 8-amino-7-oxononanoate synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5XZ74 7.6e-56 191 33 6 386 3 bioF 8-amino-7-oxononanoate synthase Klebsiella pneumoniae (strain 342)
Q12D74 8.32e-56 191 34 8 402 3 bioF2 8-amino-7-oxononanoate synthase 2 Polaromonas sp. (strain JS666 / ATCC BAA-500)
B7LJY7 1.06e-55 191 33 6 380 3 bioF 8-amino-7-oxononanoate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P74770 1.45e-55 191 32 5 382 3 bioF Putative 8-amino-7-oxononanoate synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7RVY5 1.52e-55 196 31 9 411 3 alv-1 5-aminolevulinate synthase, mitochondrial Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A6T6L6 1.66e-55 190 34 4 345 3 bioF 8-amino-7-oxononanoate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q7NPW2 1.82e-55 190 35 5 359 3 bioF 8-amino-7-oxononanoate synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B7NA75 2.25e-55 190 35 5 349 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B6ESC6 4.52e-55 189 30 6 389 3 bioF 8-amino-7-oxononanoate synthase Aliivibrio salmonicida (strain LFI1238)
Q1RIV2 5.14e-55 190 29 6 398 3 hemA 5-aminolevulinate synthase Rickettsia bellii (strain RML369-C)
Q8YZT3 6.83e-55 189 35 4 351 3 bioF Putative 8-amino-7-oxononanoate synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q75DX7 8.51e-55 192 31 6 373 3 HEM1 5-aminolevulinate synthase, mitochondrial Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q7VWP1 1.08e-54 188 32 6 381 3 bioF Putative 8-amino-7-oxononanoate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P08080 1.31e-54 188 33 7 396 3 hemA 5-aminolevulinate synthase Rhizobium meliloti (strain 1021)
B8F713 1.66e-54 187 30 5 375 3 bioF Putative 8-amino-7-oxononanoate synthase Glaesserella parasuis serovar 5 (strain SH0165)
Q3JWR6 3.28e-54 187 35 6 387 3 bioF 8-amino-7-oxononanoate synthase Burkholderia pseudomallei (strain 1710b)
B0SZS9 3.48e-54 187 34 7 381 3 bioF Putative 8-amino-7-oxononanoate synthase Caulobacter sp. (strain K31)
Q63Y23 3.69e-54 187 35 6 387 3 bioF 8-amino-7-oxononanoate synthase Burkholderia pseudomallei (strain K96243)
A3N522 3.69e-54 187 35 6 387 3 bioF 8-amino-7-oxononanoate synthase Burkholderia pseudomallei (strain 668)
A3NQS3 3.69e-54 187 35 6 387 3 bioF 8-amino-7-oxononanoate synthase Burkholderia pseudomallei (strain 1106a)
A1V819 3.69e-54 187 35 6 387 3 bioF 8-amino-7-oxononanoate synthase Burkholderia mallei (strain SAVP1)
Q62MX1 3.69e-54 187 35 6 387 3 bioF 8-amino-7-oxononanoate synthase Burkholderia mallei (strain ATCC 23344)
A2S7R1 3.69e-54 187 35 6 387 3 bioF 8-amino-7-oxononanoate synthase Burkholderia mallei (strain NCTC 10229)
A3MNG3 3.69e-54 187 35 6 387 3 bioF 8-amino-7-oxononanoate synthase Burkholderia mallei (strain NCTC 10247)
C0PWY3 4.19e-54 186 32 5 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella paratyphi C (strain RKS4594)
Q12F38 4.66e-54 187 34 5 362 3 bioF1 8-amino-7-oxononanoate synthase 1 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q7W9I4 6.25e-54 186 33 5 354 3 bioF Putative 8-amino-7-oxononanoate synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A9MTI7 6.47e-54 186 32 5 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
C4LK80 7.78e-54 193 32 9 417 3 bioWF Biotin biosynthesis bifunctional protein BioWF Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
B2UBJ3 9.78e-54 186 36 7 369 3 bioF 8-amino-7-oxononanoate synthase Ralstonia pickettii (strain 12J)
Q57RG2 1.73e-53 185 32 5 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella choleraesuis (strain SC-B67)
Q7WH76 2.11e-53 185 33 5 354 3 bioF Putative 8-amino-7-oxononanoate synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8Z892 2.42e-53 184 32 5 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella typhi
B5R762 2.42e-53 184 32 5 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QX66 2.42e-53 184 32 5 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella enteritidis PT4 (strain P125109)
A1WVM6 2.69e-53 185 32 4 379 3 bioF 8-amino-7-oxononanoate synthase Halorhodospira halophila (strain DSM 244 / SL1)
B5BC30 3.82e-53 184 32 7 392 3 bioF 8-amino-7-oxononanoate synthase Salmonella paratyphi A (strain AKU_12601)
Q5PG49 3.82e-53 184 32 7 392 3 bioF 8-amino-7-oxononanoate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZQQ7 4.16e-53 184 32 5 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TC49 4.43e-53 184 32 5 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella heidelberg (strain SL476)
Q9KSZ3 5.45e-53 184 33 8 383 3 bioF 8-amino-7-oxononanoate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B4TQU0 8e-53 183 32 5 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella schwarzengrund (strain CVM19633)
A9HVE9 8.26e-53 183 35 4 367 3 bioF 8-amino-7-oxononanoate synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B5FP62 1.01e-52 183 32 5 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella dublin (strain CT_02021853)
O14092 1.07e-52 187 31 7 381 3 hem1 5-aminolevulinate synthase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0L3L7 1.71e-52 182 31 4 361 3 bioF Putative 8-amino-7-oxononanoate synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B5F073 2.13e-52 182 31 7 400 3 bioF 8-amino-7-oxononanoate synthase Salmonella agona (strain SL483)
B2FLM5 6.28e-52 181 36 3 349 3 bioF 8-amino-7-oxononanoate synthase Stenotrophomonas maltophilia (strain K279a)
Q9NUV7 8.36e-52 184 33 7 369 1 SPTLC3 Serine palmitoyltransferase 3 Homo sapiens
Q09925 9.08e-52 185 31 8 387 3 lcb2 Serine palmitoyltransferase 2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B4SZJ8 1.2e-51 180 32 5 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella newport (strain SL254)
Q92G23 1.56e-51 181 29 7 399 3 hemA 5-aminolevulinate synthase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q2T1Q2 1.82e-51 180 35 6 387 3 bioF 8-amino-7-oxononanoate synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q3SLX9 1.92e-51 179 34 5 378 3 bioF 8-amino-7-oxononanoate synthase Thiobacillus denitrificans (strain ATCC 25259)
P18080 2.6e-51 182 34 12 393 2 ALAS2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Gallus gallus
Q0BUV6 2.95e-51 179 34 7 346 3 GbCGDNIH1_0498 8-amino-7-oxononanoate synthase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
A5UCE4 3.9e-51 179 29 6 382 3 bioF Putative 8-amino-7-oxononanoate synthase Haemophilus influenzae (strain PittEE)
Q9CJU0 5.18e-51 178 31 4 352 3 bioF Putative 8-amino-7-oxononanoate synthase Pasteurella multocida (strain Pm70)
Q4UJV4 5.27e-51 179 29 7 399 3 hemA 5-aminolevulinate synthase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B4SM82 5.31e-51 179 35 3 349 3 bioF 8-amino-7-oxononanoate synthase Stenotrophomonas maltophilia (strain R551-3)
A9MJE5 8.02e-51 178 32 7 384 3 bioF 8-amino-7-oxononanoate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P36570 9.03e-51 177 32 7 381 3 bioF 8-amino-7-oxononanoate synthase Serratia marcescens
A4W8B8 1.13e-50 177 31 6 390 3 bioF 8-amino-7-oxononanoate synthase Enterobacter sp. (strain 638)
A4JIB5 1.61e-50 177 35 10 394 3 bioF 8-amino-7-oxononanoate synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A5UJ44 2.21e-50 177 29 7 382 3 bioF Putative 8-amino-7-oxononanoate synthase Haemophilus influenzae (strain PittGG)
Q4QKR3 2.21e-50 177 29 7 382 3 bioF Putative 8-amino-7-oxononanoate synthase Haemophilus influenzae (strain 86-028NP)
Q7VL09 3.38e-50 176 29 5 386 3 bioF 8-amino-7-oxononanoate synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8GVE2 3.72e-50 176 36 6 368 3 bioF Putative 8-amino-7-oxononanoate synthase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A7Z1 3.72e-50 176 36 6 368 3 bioF Putative 8-amino-7-oxononanoate synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O15270 8.65e-50 179 32 6 369 1 SPTLC2 Serine palmitoyltransferase 2 Homo sapiens
A8AJ11 8.73e-50 175 32 6 381 3 bioF 8-amino-7-oxononanoate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P48241 1.74e-49 178 32 9 369 3 LCB2 Serine palmitoyltransferase 2 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
A3Q146 1.76e-49 174 34 6 345 3 Mjls_3094 8-amino-7-oxononanoate synthase Mycobacterium sp. (strain JLS)
A1TTV0 2.09e-49 175 32 8 399 3 bioF 8-amino-7-oxononanoate synthase Paracidovorax citrulli (strain AAC00-1)
B8ERL9 2.55e-49 173 34 4 352 3 Msil_2132 8-amino-7-oxononanoate synthase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q9ZCB8 2.75e-49 174 29 9 401 3 hemA 5-aminolevulinate synthase Rickettsia prowazekii (strain Madrid E)
Q1B7F0 3.41e-49 174 34 6 345 3 Mmcs_3077 8-amino-7-oxononanoate synthase Mycobacterium sp. (strain MCS)
A1UHM3 3.41e-49 174 34 6 345 3 Mkms_3137 8-amino-7-oxononanoate synthase Mycobacterium sp. (strain KMS)
Q8BG54 3.74e-49 177 31 7 372 2 Sptlc3 Serine palmitoyltransferase 3 Mus musculus
Q2W3L2 3.83e-49 174 29 5 386 3 bioF Putative 8-amino-7-oxononanoate synthase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P44422 4.65e-49 173 29 6 375 3 bioF Putative 8-amino-7-oxononanoate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3B7D2 5.11e-49 177 31 6 369 1 Sptlc2 Serine palmitoyltransferase 2 Rattus norvegicus
D4H9Y2 1.14e-48 178 30 6 391 3 HMPREF0675_4919 Biotin biosynthesis bifunctional protein BioWF Cutibacterium acnes (strain SK137)
P97363 1.29e-48 176 31 6 369 1 Sptlc2 Serine palmitoyltransferase 2 Mus musculus
B7L0L2 2.51e-48 171 34 6 353 3 Mchl_0816 8-amino-7-oxononanoate synthase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q68VS3 2.55e-48 172 29 9 401 3 hemA 5-aminolevulinate synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q6A6M4 3.18e-48 176 30 6 391 3 PPA1866 Biotin biosynthesis bifunctional protein BioWF Cutibacterium acnes (strain DSM 16379 / KPA171202)
A1JS67 4.03e-48 171 33 3 340 3 bioF 8-amino-7-oxononanoate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q39CE6 7.87e-48 171 35 10 400 3 bioF 8-amino-7-oxononanoate synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A9W106 9.04e-48 170 34 6 353 3 Mext_0857 8-amino-7-oxononanoate synthase Methylorubrum extorquens (strain PA1)
Q9XVI6 9.17e-48 173 30 10 369 3 sptl-3 Serine palmitoyltransferase 3 Caenorhabditis elegans
A1ITK1 1.03e-47 169 31 8 352 3 bioF Putative 8-amino-7-oxononanoate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M251 1.03e-47 169 31 8 352 3 bioF Putative 8-amino-7-oxononanoate synthase Neisseria meningitidis serogroup C (strain 053442)
B4E9L6 1.21e-47 170 35 10 400 3 bioF 8-amino-7-oxononanoate synthase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
O54694 1.32e-47 173 32 8 371 2 SPTLC2 Serine palmitoyltransferase 2 Cricetulus griseus
B1YNS0 1.77e-47 171 36 11 395 3 bioF 8-amino-7-oxononanoate synthase Burkholderia ambifaria (strain MC40-6)
Q8GW43 2.18e-47 171 30 6 383 1 BIOF 8-amino-7-oxononanoate synthase Arabidopsis thaliana
B4RP93 2.59e-47 169 31 8 352 3 bioF Putative 8-amino-7-oxononanoate synthase Neisseria gonorrhoeae (strain NCCP11945)
Q0BBD6 3.59e-47 170 36 11 403 3 bioF 8-amino-7-oxononanoate synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q5F6R6 4.07e-47 168 31 8 352 3 bioF Putative 8-amino-7-oxononanoate synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4RFX5 4.57e-47 168 36 4 347 3 bioF Putative 8-amino-7-oxononanoate synthase Phenylobacterium zucineum (strain HLK1)
Q8XZC3 4.58e-47 169 34 10 401 3 bioF 8-amino-7-oxononanoate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B8IBW2 8.55e-47 167 35 6 351 3 Mnod_6357 8-amino-7-oxononanoate synthase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A1KVF6 1.34e-46 167 30 5 346 3 bioF Putative 8-amino-7-oxononanoate synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P40970 2.22e-46 170 31 8 368 1 LCB2 Serine palmitoyltransferase 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q54EX5 3.31e-46 168 30 8 377 1 sptB Serine palmitoyltransferase 2 Dictyostelium discoideum
Q1BT36 3.59e-46 166 35 10 393 3 bioF 8-amino-7-oxononanoate synthase Burkholderia orbicola (strain AU 1054)
A0KB03 3.59e-46 166 35 10 393 3 bioF 8-amino-7-oxononanoate synthase Burkholderia cenocepacia (strain HI2424)
B1JZD9 5.4e-46 166 35 10 393 3 bioF 8-amino-7-oxononanoate synthase Burkholderia orbicola (strain MC0-3)
Q20375 1.06e-45 168 33 8 360 3 sptl-2 Serine palmitoyltransferase 2 Caenorhabditis elegans
Q9K0U0 1.16e-45 164 30 8 352 3 bioF Putative 8-amino-7-oxononanoate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9AE46 1.47e-45 164 35 8 383 1 bioF 8-amino-7-oxononanoate synthase Burkholderia multivorans (strain ATCC 17616 / 249)
Q1LS75 3.24e-45 164 32 5 367 3 bioF 8-amino-7-oxononanoate synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A4T9L3 1.27e-44 161 32 6 340 3 Mflv_3628 8-amino-7-oxononanoate synthase Mycolicibacterium gilvum (strain PYR-GCK)
Q2R3K3 1.53e-44 164 29 8 387 2 Os11g0516000 Long chain base biosynthesis protein 2a Oryza sativa subsp. japonica
Q66D66 2.65e-44 160 30 4 381 3 bioF 8-amino-7-oxononanoate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K8T1 2.65e-44 160 30 4 381 3 bioF 8-amino-7-oxononanoate synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JSS3 3.3e-44 160 30 4 381 3 bioF 8-amino-7-oxononanoate synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FKM8 3.3e-44 160 30 4 381 3 bioF 8-amino-7-oxononanoate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A0QX65 4.89e-44 160 34 6 338 1 bioF 8-amino-7-oxononanoate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8RYL0 8.95e-44 162 29 9 373 3 Os01g0928700 Long chain base biosynthesis protein 2c Oryza sativa subsp. japonica
B1LYP9 9.75e-44 159 35 6 338 3 Mrad2831_0866 8-amino-7-oxononanoate synthase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A4TNQ5 1.09e-43 159 30 4 381 3 bioF 8-amino-7-oxononanoate synthase Yersinia pestis (strain Pestoides F)
Q1CFQ4 1.09e-43 159 30 4 381 3 bioF 8-amino-7-oxononanoate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R3C9 1.09e-43 159 30 4 381 3 bioF 8-amino-7-oxononanoate synthase Yersinia pestis bv. Antiqua (strain Angola)
Q7CH66 1.09e-43 159 30 4 381 3 bioF 8-amino-7-oxononanoate synthase Yersinia pestis
Q1C946 1.09e-43 159 30 4 381 3 bioF 8-amino-7-oxononanoate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
Q5JK39 3.29e-43 160 29 9 373 2 Os01g0928800 Long chain base biosynthesis protein 2d Oryza sativa subsp. japonica
A1T8U6 1.09e-42 156 33 7 342 3 Mvan_2789 8-amino-7-oxononanoate synthase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
B1Z7Y8 1.35e-42 156 34 5 345 3 Mpop_0781 8-amino-7-oxononanoate synthase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q9LSZ9 1.37e-42 158 29 10 371 1 LCB2a Long chain base biosynthesis protein 2a Arabidopsis thaliana
Q9M304 3.37e-42 157 29 9 370 1 LCB2b Long chain base biosynthesis protein 2b Arabidopsis thaliana
B0UKC8 1.33e-41 153 32 4 370 3 M446_5168 8-amino-7-oxononanoate synthase Methylobacterium sp. (strain 4-46)
Q8RYL1 1.53e-41 155 28 9 387 2 Os01g0928600 Long chain base biosynthesis protein 2b Oryza sativa subsp. japonica
Q94IB8 3.96e-40 152 29 4 299 1 LCB1 Long chain base biosynthesis protein 1 Arabidopsis thaliana
A0PP02 6.62e-40 149 31 6 348 3 MUL_1560 8-amino-7-oxononanoate synthase Mycobacterium ulcerans (strain Agy99)
Q477A3 9.21e-40 149 30 6 395 3 bioF 8-amino-7-oxononanoate synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q10P01 1.12e-39 150 29 8 382 2 Os03g0252800 Long chain base biosynthesis protein 1a Oryza sativa subsp. japonica
P45487 5.86e-39 146 32 4 341 3 ML1217 8-amino-7-oxononanoate synthase Mycobacterium leprae (strain TN)
B8ZR84 5.86e-39 146 32 4 341 3 MLBr01217 8-amino-7-oxononanoate synthase Mycobacterium leprae (strain Br4923)
Q6K8E7 1.26e-38 147 31 3 282 2 Os02g0806900 Long chain base biosynthesis protein 1b Oryza sativa subsp. japonica
Q7G4P2 4.11e-37 143 31 4 282 2 Os10g0189600 Long chain base biosynthesis protein 1c Oryza sativa subsp. japonica
Q55FL5 5.96e-37 143 27 9 395 3 sptA Serine palmitoyltransferase 1 Dictyostelium discoideum
Q740R7 1.36e-36 140 31 6 344 3 MAP_1275 8-amino-7-oxononanoate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A5WMQ5 1.69e-36 140 31 4 341 3 TBFG_11601 8-amino-7-oxononanoate synthase Mycobacterium tuberculosis (strain F11)
A5U2S6 1.69e-36 140 31 4 341 3 MRA_1581 8-amino-7-oxononanoate synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KJ00 1.69e-36 140 31 4 341 3 BCG_1622 8-amino-7-oxononanoate synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A4X5 1.69e-36 140 31 4 341 3 BQ2027_MB1596 8-amino-7-oxononanoate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQ87 1.69e-36 140 31 4 341 1 bioF1 8-amino-7-oxononanoate synthase 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ86 1.69e-36 140 31 4 341 3 bioF1 8-amino-7-oxononanoate synthase 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B2HQ90 1.23e-35 137 32 6 348 3 MMAR_2384 8-amino-7-oxononanoate synthase Mycobacterium marinum (strain ATCC BAA-535 / M)
A0QHJ9 8.87e-35 135 31 6 344 3 MAV_3205 8-amino-7-oxononanoate synthase Mycobacterium avium (strain 104)
A7N6R9 3.2e-30 123 24 3 338 1 cqsA CAI-1 autoinducer synthase Vibrio campbellii (strain ATCC BAA-1116)
O54695 3.44e-30 124 25 8 384 1 SPTLC1 Serine palmitoyltransferase 1 Cricetulus griseus
D4A2H2 6.72e-30 123 25 8 386 1 Sptlc1 Serine palmitoyltransferase 1 Rattus norvegicus
O35704 9.38e-30 123 25 8 384 1 Sptlc1 Serine palmitoyltransferase 1 Mus musculus
Q9KM65 1.35e-29 121 26 5 337 1 cqsA CAI-1 autoinducer synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q60HD1 1.94e-29 122 25 8 393 2 SPTLC1 Serine palmitoyltransferase 1 Macaca fascicularis
Q3MHG1 4.56e-29 121 25 8 393 2 SPTLC1 Serine palmitoyltransferase 1 Bos taurus
O15269 5.55e-29 120 25 7 389 1 SPTLC1 Serine palmitoyltransferase 1 Homo sapiens
C8V1D1 6.38e-29 119 25 11 388 2 bioF 8-amino-7-oxononanoate synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5R9T5 4.09e-28 118 25 8 393 2 SPTLC1 Serine palmitoyltransferase 1 Pongo abelii
O59682 4.16e-28 119 26 9 371 3 lcb1 Serine palmitoyltransferase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P25045 2.05e-25 111 28 7 268 1 LCB1 Serine palmitoyltransferase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P91079 2.75e-24 107 27 7 290 3 sptl-1 Serine palmitoyltransferase 1 Caenorhabditis elegans
Q9ZLN3 2.35e-20 95 26 12 356 3 jhp_0545 8-amino-7-oxononanoate synthase Helicobacter pylori (strain J99 / ATCC 700824)
O25320 2.93e-20 94 26 6 279 3 HP_0598 8-amino-7-oxononanoate synthase Helicobacter pylori (strain ATCC 700392 / 26695)
A0A3G9HHK2 7.21e-16 83 23 9 375 3 ALT4 Aminotransferase ALT4 Alternaria alternata
A8MGL7 6.88e-09 60 28 6 177 3 glyA Serine hydroxymethyltransferase Alkaliphilus oremlandii (strain OhILAs)
O29406 3.65e-08 58 28 1 130 3 glyA Serine hydroxymethyltransferase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A6TQQ1 9.05e-08 57 28 5 175 3 glyA Serine hydroxymethyltransferase Alkaliphilus metalliredigens (strain QYMF)
W7L9E0 1.63e-07 57 24 3 202 2 FUM8 Aminotransferase FUM8 Gibberella moniliformis (strain M3125 / FGSC 7600)
Q65DW5 3.6e-07 55 28 6 177 3 glyA Serine hydroxymethyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8XJ32 4.64e-07 55 29 4 161 3 glyA Serine hydroxymethyltransferase Clostridium perfringens (strain 13 / Type A)
Q1D345 7.56e-07 54 25 9 266 3 glyA Serine hydroxymethyltransferase Myxococcus xanthus (strain DK1622)
A5N7P5 8.97e-07 54 24 12 294 3 glyA Serine hydroxymethyltransferase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E156 8.97e-07 54 24 12 294 3 glyA Serine hydroxymethyltransferase Clostridium kluyveri (strain NBRC 12016)
A0B8J6 9.19e-07 54 26 5 177 3 glyA Serine hydroxymethyltransferase Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
Q0SRQ2 9.87e-07 54 28 4 161 3 glyA Serine hydroxymethyltransferase Clostridium perfringens (strain SM101 / Type A)
B2V398 1.03e-06 54 28 4 162 3 glyA Serine hydroxymethyltransferase Clostridium botulinum (strain Alaska E43 / Type E3)
Q0TP32 1.09e-06 53 28 4 161 3 glyA Serine hydroxymethyltransferase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q6MLK1 1.11e-06 53 30 6 172 3 glyA Serine hydroxymethyltransferase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B2TN52 1.79e-06 53 27 3 162 3 glyA Serine hydroxymethyltransferase Clostridium botulinum (strain Eklund 17B / Type B)
C6E348 2.16e-06 53 28 9 210 3 glyA Serine hydroxymethyltransferase Geobacter sp. (strain M21)
B9MR57 2.27e-06 53 25 4 162 3 glyA Serine hydroxymethyltransferase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B2A3H6 2.34e-06 53 26 5 178 3 glyA Serine hydroxymethyltransferase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B5E8U0 4.3e-06 52 27 9 210 3 glyA Serine hydroxymethyltransferase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q183G0 5.91e-06 51 27 6 166 3 glyA Serine hydroxymethyltransferase Clostridioides difficile (strain 630)
A4XL61 6.26e-06 51 26 4 161 3 glyA Serine hydroxymethyltransferase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B8I2N8 6.48e-06 51 23 5 188 3 glyA Serine hydroxymethyltransferase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q39V87 7.92e-06 51 29 9 210 3 glyA Serine hydroxymethyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B7GMG4 8.4e-06 51 27 6 177 3 glyA Serine hydroxymethyltransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q97GV1 8.9e-06 51 26 5 163 3 glyA Serine hydroxymethyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q3A934 1.15e-05 50 27 5 177 3 glyA Serine hydroxymethyltransferase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q2ST43 1.19e-05 50 25 9 229 3 glyA Serine hydroxymethyltransferase Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
A1A1V0 1.21e-05 50 25 8 206 3 glyA Serine hydroxymethyltransferase Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
P39148 1.22e-05 50 28 5 162 1 glyA Serine hydroxymethyltransferase Bacillus subtilis (strain 168)
A5GF66 1.56e-05 50 28 5 167 3 glyA Serine hydroxymethyltransferase Geotalea uraniireducens (strain Rf4)
Q5KUI2 1.73e-05 50 27 6 179 3 glyA Serine hydroxymethyltransferase Geobacillus kaustophilus (strain HTA426)
Q2NIT8 1.83e-05 50 23 8 220 3 glyA Serine hydroxymethyltransferase Aster yellows witches'-broom phytoplasma (strain AYWB)
Q6AM21 1.99e-05 50 25 9 245 3 glyA Serine hydroxymethyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q74CR5 2.08e-05 50 28 9 208 3 glyA Serine hydroxymethyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A4ITJ9 2.34e-05 50 26 6 179 3 glyA Serine hydroxymethyltransferase Geobacillus thermodenitrificans (strain NG80-2)
B3E1Z8 2.73e-05 49 26 5 167 3 glyA Serine hydroxymethyltransferase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B9DMF3 3.9e-05 49 26 5 161 3 glyA Serine hydroxymethyltransferase Staphylococcus carnosus (strain TM300)
Q6YR37 4.1e-05 49 23 7 218 3 glyA Serine hydroxymethyltransferase Onion yellows phytoplasma (strain OY-M)
Q6MS85 4.27e-05 48 25 9 229 3 glyA Serine hydroxymethyltransferase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
B9M0W5 4.28e-05 48 27 9 208 3 glyA Serine hydroxymethyltransferase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q49Z60 4.74e-05 48 26 6 162 3 glyA Serine hydroxymethyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q5JF06 4.93e-05 48 22 12 353 3 glyA Serine hydroxymethyltransferase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
A9WI58 5.05e-05 48 27 10 269 3 glyA Serine hydroxymethyltransferase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A9VSB4 5.46e-05 48 26 6 175 3 glyA Serine hydroxymethyltransferase Bacillus mycoides (strain KBAB4)
A7Z9Q9 5.78e-05 48 27 5 162 3 glyA Serine hydroxymethyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A6LUK9 6.27e-05 48 27 5 173 3 glyA Serine hydroxymethyltransferase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
O66776 6.45e-05 48 26 7 209 3 glyA Serine hydroxymethyltransferase Aquifex aeolicus (strain VF5)
A7GGI2 7.78e-05 48 24 8 235 3 glyA Serine hydroxymethyltransferase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A3DEB1 9.77e-05 47 26 5 164 3 glyA Serine hydroxymethyltransferase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B5YFZ0 0.000108 47 25 4 171 3 glyA Serine hydroxymethyltransferase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
B1IJJ8 0.000114 47 24 8 235 3 glyA Serine hydroxymethyltransferase Clostridium botulinum (strain Okra / Type B1)
B7IQW9 0.000117 47 26 5 173 3 glyA Serine hydroxymethyltransferase Bacillus cereus (strain G9842)
P50436 0.000118 47 27 1 117 3 glyA Serine hydroxymethyltransferase Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
B1KXQ5 0.000119 47 24 8 235 3 glyA Serine hydroxymethyltransferase Clostridium botulinum (strain Loch Maree / Type A3)
C3L181 0.000119 47 24 8 235 3 glyA Serine hydroxymethyltransferase Clostridium botulinum (strain 657 / Type Ba4)
B9LKK8 0.000121 47 29 5 179 3 glyA Serine hydroxymethyltransferase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
B7HFL3 0.00013 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus cereus (strain B4264)
B7HY76 0.000131 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus cereus (strain AH187)
A1USI0 0.000136 47 26 6 195 3 glyA Serine hydroxymethyltransferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q81JY4 0.000139 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus anthracis
C3LFJ0 0.000139 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P1G5 0.000139 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus anthracis (strain A0248)
Q814V2 0.000144 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
C1F0N9 0.000145 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus cereus (strain 03BB102)
B7JGP1 0.000145 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus cereus (strain AH820)
B9IRU8 0.000147 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus cereus (strain Q1)
Q72XD7 0.000147 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q630T3 0.000148 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus cereus (strain ZK / E33L)
A5I526 0.000159 47 24 4 161 3 glyA Serine hydroxymethyltransferase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FWM6 0.000159 47 24 4 161 3 glyA Serine hydroxymethyltransferase Clostridium botulinum (strain ATCC 19397 / Type A)
C1FTF1 0.00016 47 24 4 161 3 glyA Serine hydroxymethyltransferase Clostridium botulinum (strain Kyoto / Type A2)
Q6HAW9 0.000161 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
A0RLA3 0.000161 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus thuringiensis (strain Al Hakam)
Q6F211 0.000193 47 25 5 156 3 glyA Serine hydroxymethyltransferase Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
A7GV66 0.000198 47 25 6 175 3 glyA Serine hydroxymethyltransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7GTL3 0.000201 47 25 5 163 3 glyA Serine hydroxymethyltransferase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
B9KZ44 0.000211 47 27 6 179 3 glyA Serine hydroxymethyltransferase Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
C0QQE4 0.000217 47 27 5 150 3 glyA Serine hydroxymethyltransferase Persephonella marina (strain DSM 14350 / EX-H1)
C5A6G2 0.000303 46 27 5 181 3 glyA Serine hydroxymethyltransferase Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Q4L7Z4 0.000332 46 25 4 142 3 glyA Serine hydroxymethyltransferase Staphylococcus haemolyticus (strain JCSC1435)
B1HM45 0.000383 46 22 8 265 3 glyA Serine hydroxymethyltransferase Lysinibacillus sphaericus (strain C3-41)
Q8CRN3 0.000411 45 24 5 161 3 glyA Serine hydroxymethyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HMB0 0.000411 45 24 5 161 3 glyA Serine hydroxymethyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8EM73 0.000436 45 25 7 191 3 glyA Serine hydroxymethyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A8FIC1 0.000496 45 26 5 175 3 glyA Serine hydroxymethyltransferase Bacillus pumilus (strain SAFR-032)
Q7MAR0 0.000529 45 27 5 167 3 glyA Serine hydroxymethyltransferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A0PZX4 0.000583 45 24 6 175 3 glyA Serine hydroxymethyltransferase Clostridium novyi (strain NT)
Q24MM6 0.000583 45 26 5 174 3 glyA Serine hydroxymethyltransferase Desulfitobacterium hafniense (strain Y51)
P66804 0.000845 45 25 5 160 3 glyA Serine hydroxymethyltransferase Staphylococcus aureus (strain MW2)
Q6G7J7 0.000845 45 25 5 160 3 glyA Serine hydroxymethyltransferase Staphylococcus aureus (strain MSSA476)
Q6GEW2 0.000845 45 25 5 160 3 glyA Serine hydroxymethyltransferase Staphylococcus aureus (strain MRSA252)
P99091 0.000845 45 25 5 160 1 glyA Serine hydroxymethyltransferase Staphylococcus aureus (strain N315)
P66803 0.000845 45 25 5 160 3 glyA Serine hydroxymethyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QIV7 0.000845 45 25 5 160 3 glyA Serine hydroxymethyltransferase Staphylococcus aureus (strain Newman)
Q5HE87 0.000845 45 25 5 160 1 glyA Serine hydroxymethyltransferase Staphylococcus aureus (strain COL)
A5IUQ8 0.000845 45 25 5 160 3 glyA Serine hydroxymethyltransferase Staphylococcus aureus (strain JH9)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15710
Feature type CDS
Gene -
Product glycine C-acetyltransferase
Location 3489901 - 3491100 (strand: 1)
Length 1200 (nucleotides) / 399 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_323
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00155 Aminotransferase class I and II

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0156 Coenzyme transport and metabolism (H) H 7-keto-8-aminopelargonate synthetase or related enzyme

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00639 glycine C-acetyltransferase [EC:2.3.1.29] Glycine, serine and threonine metabolism
Metabolic pathways		 -

Protein Sequence

MSTHSFYQQINQQLEQTRQDGLFKNERIITSSQSADIAVADGSHVINFCANNYLGLANHPQLIAAAKAGMDSHGFGMASVRFICGTQDLHKTLEKNIAEFLGMEDAILYSSCFDANGGLFETLMGSEDAIISDALNHASIIDGVRLCKAKRYRYANNDMAVLRAQLEQAKADNARHIMIATDGVFSMDGVIADLKSICDLADEYGALVMVDDSHAVGFVGTQGRGTHEYCDVLDRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVSASIAVLDMLKSGDELRACLWRNAALFREKMTAAGFTLAGADHAIIPVMLGDAKLAQQFAARLLDEGIYVTGFFYPVVPQGQARIRTQMSAAHTPEQIERAIAAFIKIGKQLNVIA

Flanking regions ( +/- flanking 50bp)

ATAGTCAACTCTAGCTCTTATCTCTTTTCGTCTCTGCCTTAGGAGAAAGCATGTCTACTCACTCTTTCTATCAACAAATTAATCAACAACTCGAACAAACACGTCAAGATGGCTTATTTAAAAATGAGCGGATCATCACTTCTTCGCAAAGTGCCGATATTGCGGTTGCTGATGGTAGTCATGTTATTAACTTTTGTGCCAATAACTACTTAGGTTTAGCTAACCACCCACAACTTATTGCAGCGGCGAAAGCGGGAATGGATAGCCACGGTTTTGGTATGGCATCGGTACGTTTTATCTGCGGAACGCAAGATCTACATAAAACATTAGAAAAGAACATCGCTGAATTTTTGGGTATGGAAGATGCCATTTTGTACTCCTCTTGTTTTGATGCCAATGGTGGGTTATTTGAAACACTGATGGGATCTGAAGATGCAATTATTTCTGATGCGCTAAATCACGCATCGATTATTGATGGTGTTCGTTTATGTAAAGCCAAGCGTTATCGCTATGCCAATAACGATATGGCGGTGTTACGTGCCCAACTTGAACAGGCCAAAGCAGATAATGCCCGCCATATTATGATTGCCACCGATGGGGTGTTCTCTATGGATGGGGTGATTGCTGATCTAAAAAGTATCTGTGATTTGGCTGACGAATATGGCGCATTAGTGATGGTCGATGACTCGCATGCGGTGGGTTTTGTCGGCACACAAGGGCGCGGTACTCATGAGTATTGTGATGTATTAGATCGCGTCGATATCATCACAGGAACATTAGGTAAAGCTTTAGGTGGCGCATCGGGTGGTTATACCGCAGCTCGTAAAGAAGTGGTGGAGTGGTTACGTCAACGCTCTCGTCCTTATCTATTCTCAAATTCTTTAGCCCCTGCAATTGTGAGCGCCTCTATTGCAGTTTTAGATATGCTGAAATCAGGGGATGAACTGCGCGCTTGTTTATGGCGTAACGCAGCACTTTTTCGTGAAAAAATGACGGCAGCAGGTTTTACTTTGGCGGGGGCTGATCACGCGATTATTCCTGTGATGTTAGGAGATGCCAAACTAGCGCAACAATTTGCAGCACGTTTACTTGATGAAGGTATTTATGTCACTGGCTTTTTCTACCCAGTAGTACCACAAGGGCAAGCACGTATTCGTACACAAATGTCAGCGGCACACACCCCAGAACAAATTGAACGTGCTATTGCTGCATTTATTAAAATCGGTAAGCAACTTAATGTGATTGCATAAGGTTCTAATATGAAAGCATTGTCAAAATTAAAAGCACAACCCGGTATCTG