Homologs in group_294

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09615 FBDBKF_09615 56.9 Morganella morganii S1 bioF 8-amino-7-oxononanoate synthase
EHELCC_04415 EHELCC_04415 56.9 Morganella morganii S2 bioF 8-amino-7-oxononanoate synthase
NLDBIP_04415 NLDBIP_04415 56.9 Morganella morganii S4 bioF 8-amino-7-oxononanoate synthase
LHKJJB_14215 LHKJJB_14215 56.9 Morganella morganii S3 bioF 8-amino-7-oxononanoate synthase
HKOGLL_12320 HKOGLL_12320 56.9 Morganella morganii S5 bioF 8-amino-7-oxononanoate synthase
F4V73_RS00725 F4V73_RS00725 56.9 Morganella psychrotolerans bioF 8-amino-7-oxononanoate synthase
PMI_RS15710 PMI_RS15710 32.6 Proteus mirabilis HI4320 - glycine C-acetyltransferase

Distribution of the homologs in the orthogroup group_294

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_294

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ESU4 0.0 802 100 0 387 3 bioF 8-amino-7-oxononanoate synthase Proteus mirabilis (strain HI4320)
Q7N6Q6 2.28e-172 488 63 1 382 3 bioF 8-amino-7-oxononanoate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D3C0 4.66e-147 424 58 2 381 3 bioF 8-amino-7-oxononanoate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q47829 4.98e-147 424 58 3 383 3 bioF 8-amino-7-oxononanoate synthase Pseudescherichia vulneris
A6T6L6 4.14e-145 419 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q8Z892 9.49e-145 419 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella typhi
B5R762 9.49e-145 419 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QX66 9.49e-145 419 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella enteritidis PT4 (strain P125109)
A9MTI7 1.27e-144 418 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TC49 1.36e-144 418 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella heidelberg (strain SL476)
A9MJE5 1.81e-144 418 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3Z408 1.93e-144 418 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Shigella sonnei (strain Ss046)
C0PWY3 2.13e-144 417 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella paratyphi C (strain RKS4594)
B5BC30 2.42e-144 417 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella paratyphi A (strain AKU_12601)
Q5PG49 2.42e-144 417 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57RG2 4.18e-144 417 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella choleraesuis (strain SC-B67)
B5F073 4.98e-144 417 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella agona (strain SL483)
Q8ZQQ7 9.18e-144 416 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5FP62 1.18e-143 416 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella dublin (strain CT_02021853)
B7LJY7 1.39e-143 416 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B4TQU0 1.87e-143 415 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella schwarzengrund (strain CVM19633)
B2VBT8 2.27e-143 415 52 1 380 3 bioF 8-amino-7-oxononanoate synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B4SZJ8 4.62e-143 414 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Salmonella newport (strain SL254)
Q1REF4 6.53e-143 414 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain UTI89 / UPEC)
A1A918 6.53e-143 414 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O1:K1 / APEC
B7MGN4 6.53e-143 414 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q8FJQ2 7.21e-143 414 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7ULX3 1.01e-142 413 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0TJS2 1.39e-142 413 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MQM9 1.39e-142 413 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O81 (strain ED1a)
A8GBC6 1.21e-141 410 60 1 380 3 bioF 8-amino-7-oxononanoate synthase Serratia proteamaculans (strain 568)
A7MJ02 1.68e-140 407 55 1 380 3 bioF 8-amino-7-oxononanoate synthase Cronobacter sakazakii (strain ATCC BAA-894)
B5XZ74 7.44e-139 404 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Klebsiella pneumoniae (strain 342)
B7LC58 1.28e-138 403 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain 55989 / EAEC)
A1JS67 1.41e-138 403 57 1 382 3 bioF 8-amino-7-oxononanoate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B6I7T0 1.78e-138 402 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain SE11)
A7ZJI5 1.78e-138 402 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q324B6 2.44e-138 402 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Shigella boydii serotype 4 (strain Sb227)
B2TVF4 2.44e-138 402 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5YRL5 6.87e-138 401 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X823 6.87e-138 401 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O157:H7
B7NA75 7.42e-138 401 56 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q32I45 1.1e-137 400 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q83S45 1.98e-137 400 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Shigella flexneri
Q0T6I4 1.98e-137 400 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Shigella flexneri serotype 5b (strain 8401)
B1IXJ2 2.05e-137 400 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZY32 2.05e-137 400 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O9:H4 (strain HS)
P12998 6.29e-137 399 55 2 383 1 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain K12)
B1X7A6 6.29e-137 399 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain K12 / DH10B)
B7M748 1.38e-136 398 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O8 (strain IAI1)
B7NNK6 2.96e-136 397 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P36570 2.64e-134 392 55 5 382 3 bioF 8-amino-7-oxononanoate synthase Serratia marcescens
A4W8B8 3.63e-134 392 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Enterobacter sp. (strain 638)
B1LM67 1.06e-133 390 55 3 383 3 bioF 8-amino-7-oxononanoate synthase Escherichia coli (strain SMS-3-5 / SECEC)
Q6LPR3 1.81e-132 387 52 3 378 3 bioF 8-amino-7-oxononanoate synthase Photobacterium profundum (strain SS9)
A8AJ11 2.26e-132 387 55 2 383 3 bioF 8-amino-7-oxononanoate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q66D66 3.4e-131 384 57 2 383 3 bioF 8-amino-7-oxononanoate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K8T1 3.4e-131 384 57 2 383 3 bioF 8-amino-7-oxononanoate synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JSS3 1.17e-130 383 57 2 383 3 bioF 8-amino-7-oxononanoate synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FKM8 1.17e-130 383 57 2 383 3 bioF 8-amino-7-oxononanoate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TNQ5 4.5e-130 381 57 2 383 3 bioF 8-amino-7-oxononanoate synthase Yersinia pestis (strain Pestoides F)
Q1CFQ4 4.5e-130 381 57 2 383 3 bioF 8-amino-7-oxononanoate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R3C9 4.5e-130 381 57 2 383 3 bioF 8-amino-7-oxononanoate synthase Yersinia pestis bv. Antiqua (strain Angola)
Q7CH66 4.5e-130 381 57 2 383 3 bioF 8-amino-7-oxononanoate synthase Yersinia pestis
Q1C946 4.5e-130 381 57 2 383 3 bioF 8-amino-7-oxononanoate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
Q89AK6 2.5e-127 374 46 1 385 3 bioF 8-amino-7-oxononanoate synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B6ESC6 2.82e-127 374 50 2 367 3 bioF 8-amino-7-oxononanoate synthase Aliivibrio salmonicida (strain LFI1238)
Q2NUJ6 4.33e-127 374 53 2 385 3 bioF 8-amino-7-oxononanoate synthase Sodalis glossinidius (strain morsitans)
Q9KSZ3 3.44e-125 369 50 5 380 3 bioF 8-amino-7-oxononanoate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B5EUP9 5.37e-125 368 49 2 370 3 bioF 8-amino-7-oxononanoate synthase Aliivibrio fischeri (strain MJ11)
Q5DZH9 3.77e-124 366 48 2 370 3 bioF 8-amino-7-oxononanoate synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7MX30 6.29e-124 365 48 4 379 3 bioF 8-amino-7-oxononanoate synthase Vibrio campbellii (strain ATCC BAA-1116)
B7VH15 2.98e-120 357 46 3 377 3 bioF 8-amino-7-oxononanoate synthase Vibrio atlanticus (strain LGP32)
Q87QN5 2.19e-117 349 47 3 374 3 bioF 8-amino-7-oxononanoate synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8D8N0 5.25e-116 345 46 3 378 3 bioF 8-amino-7-oxononanoate synthase Vibrio vulnificus (strain CMCP6)
Q7MLU9 2.99e-115 343 47 3 369 3 bioF 8-amino-7-oxononanoate synthase Vibrio vulnificus (strain YJ016)
Q0VMD1 3.91e-106 320 44 2 371 3 bioF 8-amino-7-oxononanoate synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q21FY4 3.07e-104 316 42 2 383 3 bioF 8-amino-7-oxononanoate synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A0KIC7 2.05e-103 314 43 3 376 3 bioF 8-amino-7-oxononanoate synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q88A97 1.22e-102 311 44 3 376 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1I3N7 1.22e-102 311 45 3 370 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas entomophila (strain L48)
A4VR87 2.03e-102 311 44 3 376 3 bioF 8-amino-7-oxononanoate synthase Stutzerimonas stutzeri (strain A1501)
A6W0Y0 1.05e-101 310 44 4 374 3 bioF 8-amino-7-oxononanoate synthase Marinomonas sp. (strain MWYL1)
Q48CS2 3.99e-101 308 44 3 376 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A4SPR6 4.54e-101 308 44 2 346 3 bioF 8-amino-7-oxononanoate synthase Aeromonas salmonicida (strain A449)
Q3J9D6 5.58e-101 307 44 2 372 3 bioF 8-amino-7-oxononanoate synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B8GTH6 2.76e-100 305 44 4 379 3 bioF 8-amino-7-oxononanoate synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q3K5P2 3.51e-100 305 44 3 370 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas fluorescens (strain Pf0-1)
A6UYW1 8.61e-100 305 44 3 376 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas aeruginosa (strain PA7)
Q4ZMA9 1.77e-99 303 43 3 376 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas syringae pv. syringae (strain B728a)
Q9I617 3.54e-98 300 43 3 376 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A4XZR8 5.49e-98 300 44 3 364 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas mendocina (strain ymp)
B1JE54 1.36e-97 298 43 3 370 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas putida (strain W619)
Q4K4T3 1.51e-97 298 43 3 370 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q02TR5 1.63e-97 299 43 3 376 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V486 1.63e-97 299 43 3 376 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas aeruginosa (strain LESB58)
Q2SBD5 2.3e-97 298 41 2 385 3 bioF 8-amino-7-oxononanoate synthase Hahella chejuensis (strain KCTC 2396)
B0KJ54 3.21e-97 298 42 3 370 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas putida (strain GB-1)
B3PI88 1.3e-95 294 44 1 352 3 bioF 8-amino-7-oxononanoate synthase Cellvibrio japonicus (strain Ueda107)
Q0AE73 3.29e-95 292 44 2 379 3 bioF 8-amino-7-oxononanoate synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q81ZZ4 1.22e-94 291 44 4 374 3 bioF 8-amino-7-oxononanoate synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1U4B1 1.9e-94 291 42 3 374 3 bioF 8-amino-7-oxononanoate synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q47C04 3.56e-94 290 41 3 382 3 bioF 8-amino-7-oxononanoate synthase Dechloromonas aromatica (strain RCB)
Q7NPW2 5.95e-94 289 43 5 371 3 bioF 8-amino-7-oxononanoate synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0A5W2 8.4e-94 289 39 1 387 3 bioF 8-amino-7-oxononanoate synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q88QX1 1.09e-93 288 43 3 370 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q31E54 2.13e-93 288 41 4 383 3 bioF 8-amino-7-oxononanoate synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q2Y9Y8 2.13e-93 288 42 3 371 3 bioF 8-amino-7-oxononanoate synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q5NZF5 7.06e-93 286 43 1 352 3 bioF 8-amino-7-oxononanoate synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A5VXF2 1.85e-86 270 43 3 370 3 bioF 8-amino-7-oxononanoate synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4G5N9 1.05e-83 263 39 4 384 3 bioF 8-amino-7-oxononanoate synthase Herminiimonas arsenicoxydans
Q609V1 2.44e-83 262 42 3 368 3 bioF 8-amino-7-oxononanoate synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1VUJ6 1.2e-82 261 40 6 394 3 bioF 8-amino-7-oxononanoate synthase Polaromonas naphthalenivorans (strain CJ2)
A2SD53 1.12e-80 255 42 3 361 3 bioF 8-amino-7-oxononanoate synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A1K6Q1 5.69e-79 251 41 1 346 3 bioF 8-amino-7-oxononanoate synthase Azoarcus sp. (strain BH72)
B1Y500 6.14e-79 251 38 6 398 3 bioF 8-amino-7-oxononanoate synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q1GZA7 1.11e-78 250 38 2 378 3 bioF 8-amino-7-oxononanoate synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q3BYN0 2.03e-77 247 41 3 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q146K3 2.25e-77 247 41 4 348 1 bioF 8-amino-7-oxononanoate synthase Paraburkholderia xenovorans (strain LB400)
Q1QYD6 5.84e-77 245 37 3 380 3 bioF 8-amino-7-oxononanoate synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B2SWS7 9.41e-77 245 41 4 348 3 bioF 8-amino-7-oxononanoate synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q67N86 2.31e-76 244 35 3 376 3 STH1872 8-amino-7-oxononanoate synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A9BV10 3.04e-76 244 39 3 353 3 bioF 8-amino-7-oxononanoate synthase Delftia acidovorans (strain DSM 14801 / SPH-1)
P53556 4.46e-76 243 35 3 382 1 bioF 8-amino-7-oxononanoate synthase 2 Bacillus subtilis (strain 168)
B0RMR1 1.16e-75 243 40 3 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas campestris pv. campestris (strain B100)
B2JKH6 1.19e-75 242 41 5 349 1 bioF 8-amino-7-oxononanoate synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q8PDF1 1.37e-75 243 40 3 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UZN9 1.37e-75 243 40 3 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas campestris pv. campestris (strain 8004)
A7HP29 2.46e-75 241 39 4 372 3 bioF Putative 8-amino-7-oxononanoate synthase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q0KF88 4.82e-75 241 38 6 395 3 bioF 8-amino-7-oxononanoate synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A7Z4X1 8.6e-75 240 33 4 383 3 RBAM_016840 8-amino-7-oxononanoate synthase 1 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q87DT2 9e-75 240 40 2 347 3 bioF 8-amino-7-oxononanoate synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9H7 9e-75 240 40 2 347 3 bioF 8-amino-7-oxononanoate synthase Xylella fastidiosa (strain M23)
B5EEV8 9.96e-75 240 35 5 369 3 bioF 8-amino-7-oxononanoate synthase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B0U6J0 1.3e-74 240 40 2 347 3 bioF 8-amino-7-oxononanoate synthase Xylella fastidiosa (strain M12)
Q12D74 3.69e-74 239 39 7 394 3 bioF2 8-amino-7-oxononanoate synthase 2 Polaromonas sp. (strain JS666 / ATCC BAA-500)
B2AG98 3.79e-74 239 38 6 397 3 bioF 8-amino-7-oxononanoate synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q39XE0 4.85e-74 238 36 4 366 3 bioF 8-amino-7-oxononanoate synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8PQD8 5.64e-74 238 41 3 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas axonopodis pv. citri (strain 306)
B1I4F9 7.41e-74 238 39 4 352 3 bioF Putative 8-amino-7-oxononanoate synthase Desulforudis audaxviator (strain MP104C)
B5Y9Z4 2.57e-73 236 34 3 375 3 COPRO5265_1289 8-amino-7-oxononanoate synthase Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
O31777 2.84e-73 236 33 3 377 3 kbl 8-amino-7-oxononanoate synthase 1 Bacillus subtilis (strain 168)
Q1DCV8 3.07e-73 236 38 2 349 3 bioF 8-amino-7-oxononanoate synthase Myxococcus xanthus (strain DK1622)
Q9PDM2 3.77e-73 236 40 2 347 3 bioF 8-amino-7-oxononanoate synthase Xylella fastidiosa (strain 9a5c)
A5G6I9 4.06e-73 236 35 4 364 3 bioF 8-amino-7-oxononanoate synthase Geotalea uraniireducens (strain Rf4)
Q749W3 6.05e-73 235 37 5 368 3 bioF 8-amino-7-oxononanoate synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A1AQT1 7.91e-73 235 37 4 367 3 bioF 8-amino-7-oxononanoate synthase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B1YMC6 8.2e-73 235 34 3 376 3 Exig_1033 8-amino-7-oxononanoate synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q1LS75 1.41e-72 235 39 6 392 3 bioF 8-amino-7-oxononanoate synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q65ML1 4.53e-72 233 33 3 383 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q3JWR6 5.21e-72 233 40 5 365 3 bioF 8-amino-7-oxononanoate synthase Burkholderia pseudomallei (strain 1710b)
A7Z5B4 6.69e-72 233 35 3 378 3 bioF Putative 8-amino-7-oxononanoate synthase 2 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B5ELF7 1.31e-71 232 39 3 375 3 bioF 8-amino-7-oxononanoate synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J3Y7 1.31e-71 232 39 3 375 3 bioF 8-amino-7-oxononanoate synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B3EAE0 1.42e-71 232 37 7 377 3 bioF 8-amino-7-oxononanoate synthase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q63Y23 1.48e-71 232 40 5 365 3 bioF 8-amino-7-oxononanoate synthase Burkholderia pseudomallei (strain K96243)
A3N522 1.48e-71 232 40 5 365 3 bioF 8-amino-7-oxononanoate synthase Burkholderia pseudomallei (strain 668)
A3NQS3 1.48e-71 232 40 5 365 3 bioF 8-amino-7-oxononanoate synthase Burkholderia pseudomallei (strain 1106a)
A1V819 1.48e-71 232 40 5 365 3 bioF 8-amino-7-oxononanoate synthase Burkholderia mallei (strain SAVP1)
Q62MX1 1.48e-71 232 40 5 365 3 bioF 8-amino-7-oxononanoate synthase Burkholderia mallei (strain ATCC 23344)
A2S7R1 1.48e-71 232 40 5 365 3 bioF 8-amino-7-oxononanoate synthase Burkholderia mallei (strain NCTC 10229)
A3MNG3 1.48e-71 232 40 5 365 3 bioF 8-amino-7-oxononanoate synthase Burkholderia mallei (strain NCTC 10247)
Q5H5R0 1.52e-71 232 40 3 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SS66 1.52e-71 232 40 3 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P8F2 1.52e-71 232 40 3 352 3 bioF 8-amino-7-oxononanoate synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A1WVM6 1.55e-71 232 41 5 373 3 bioF 8-amino-7-oxononanoate synthase Halorhodospira halophila (strain DSM 244 / SL1)
P0AB79 5.25e-71 231 34 4 378 3 kbl 2-amino-3-ketobutyrate coenzyme A ligase Shigella flexneri
P0AB77 5.25e-71 231 34 4 378 1 kbl 2-amino-3-ketobutyrate coenzyme A ligase Escherichia coli (strain K12)
P0AB78 5.25e-71 231 34 4 378 3 kbl 2-amino-3-ketobutyrate coenzyme A ligase Escherichia coli O157:H7
P37419 9.57e-70 227 33 4 378 3 kbl 2-amino-3-ketobutyrate coenzyme A ligase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A6TU88 1.44e-69 227 33 3 378 3 Amet_3634 8-amino-7-oxononanoate synthase Alkaliphilus metalliredigens (strain QYMF)
A7HMM1 1.49e-69 227 33 5 377 3 Fnod_1307 8-amino-7-oxononanoate synthase Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
A6SU64 7.38e-69 225 37 4 374 3 bioF 8-amino-7-oxononanoate synthase Janthinobacterium sp. (strain Marseille)
Q3A3Z8 1.07e-68 224 35 8 387 3 bioF Putative 8-amino-7-oxononanoate synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B0K590 1.91e-68 224 32 4 373 3 bioF 8-amino-7-oxononanoate synthase Thermoanaerobacter sp. (strain X514)
Q2T1Q2 1.98e-68 224 38 5 383 3 bioF 8-amino-7-oxononanoate synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
P22806 4.33e-68 223 34 3 361 1 bioF 8-amino-7-oxononanoate synthase Lysinibacillus sphaericus
Q2W3L2 4.6e-68 223 38 3 347 3 bioF Putative 8-amino-7-oxononanoate synthase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A8MEX7 4.99e-68 223 34 3 377 3 Clos_0909 8-amino-7-oxononanoate synthase Alkaliphilus oremlandii (strain OhILAs)
A3DBD5 6.47e-68 222 32 2 374 3 bioF Putative 8-amino-7-oxononanoate synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B0KC20 8.34e-68 222 32 4 373 3 Teth39_0287 8-amino-7-oxononanoate synthase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q8EM07 9.04e-68 222 32 4 368 3 OB3054 Putative pyridoxal phosphate-dependent acyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8KZM9 9.43e-68 221 32 4 383 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus subtilis subsp. natto
B9M8U3 1.82e-67 221 34 4 370 3 bioF 8-amino-7-oxononanoate synthase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q5KY23 1.87e-67 221 34 2 363 3 bioF Putative 8-amino-7-oxononanoate synthase Geobacillus kaustophilus (strain HTA426)
Q3SLX9 2.77e-67 221 39 4 365 3 bioF 8-amino-7-oxononanoate synthase Thiobacillus denitrificans (strain ATCC 25259)
Q5HIC5 5.6e-67 220 33 4 372 3 SACOL0596 Putative pyridoxal phosphate-dependent acyltransferase Staphylococcus aureus (strain COL)
Q8NXY3 5.66e-67 220 33 4 372 3 MW0505 Putative pyridoxal phosphate-dependent acyltransferase Staphylococcus aureus (strain MW2)
Q6GBT7 5.66e-67 220 33 4 372 3 SAS0508 Putative pyridoxal phosphate-dependent acyltransferase Staphylococcus aureus (strain MSSA476)
P60120 5.66e-67 220 33 4 372 1 SA0508 Putative pyridoxal phosphate-dependent acyltransferase Staphylococcus aureus (strain N315)
P60121 5.66e-67 220 33 4 372 3 SAV0550 Putative pyridoxal phosphate-dependent acyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6LMP4 1.18e-66 219 31 3 372 3 bioF 8-amino-7-oxononanoate synthase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q731H9 2.56e-66 218 31 3 375 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q12F38 2.67e-66 218 38 3 388 3 bioF1 8-amino-7-oxononanoate synthase 1 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A8FDG9 4.34e-66 218 34 2 335 3 BPUM_1604 8-amino-7-oxononanoate synthase Bacillus pumilus (strain SAFR-032)
Q6GJB8 5.7e-66 217 33 4 372 3 SAR0555 Putative pyridoxal phosphate-dependent acyltransferase Staphylococcus aureus (strain MRSA252)
A7BFV8 6.05e-66 218 29 3 375 1 spt Serine palmitoyltransferase Bacteriovorax stolpii
Q477A3 8.76e-66 217 38 6 391 3 bioF 8-amino-7-oxononanoate synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A9BGL0 1.15e-65 216 31 3 377 3 Pmob_1549 8-amino-7-oxononanoate synthase Petrotoga mobilis (strain DSM 10674 / SJ95)
Q635G4 1.22e-65 216 32 3 379 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain ZK / E33L)
A1TTV0 2.6e-65 216 38 4 390 3 bioF 8-amino-7-oxononanoate synthase Paracidovorax citrulli (strain AAC00-1)
B0SZS9 3.11e-65 215 37 6 389 3 bioF Putative 8-amino-7-oxononanoate synthase Caulobacter sp. (strain K31)
B5YFU5 3.34e-65 215 33 6 384 3 bioF Putative 8-amino-7-oxononanoate synthase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
B9IWY0 3.52e-65 215 31 3 379 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain Q1)
B7HNN4 3.52e-65 215 31 3 379 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain AH187)
B7IWN1 3.58e-65 215 31 4 380 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain G9842)
A9VG56 4.29e-65 215 31 3 379 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus mycoides (strain KBAB4)
Q818X0 6.37e-65 214 31 4 380 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HAZ0 6.37e-65 214 31 4 380 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain B4264)
A8ZUS7 6.72e-65 214 32 4 381 3 bioF Putative 8-amino-7-oxononanoate synthase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
B7ID58 1.04e-64 214 31 3 372 3 bioF 8-amino-7-oxononanoate synthase Thermosipho africanus (strain TCF52B)
A9HVE9 2.98e-64 213 37 6 397 3 bioF 8-amino-7-oxononanoate synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
P44422 3.77e-64 212 36 6 341 3 bioF Putative 8-amino-7-oxononanoate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UCE4 5.72e-64 212 34 6 356 3 bioF Putative 8-amino-7-oxononanoate synthase Haemophilus influenzae (strain PittEE)
B2UBJ3 6.24e-64 213 38 6 357 3 bioF 8-amino-7-oxononanoate synthase Ralstonia pickettii (strain 12J)
Q9CJU0 8.81e-64 211 34 5 357 3 bioF Putative 8-amino-7-oxononanoate synthase Pasteurella multocida (strain Pm70)
Q81I05 1.35e-63 211 33 5 372 3 BC_0621 Putative pyridoxal phosphate-dependent acyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B4UCB1 1.38e-63 211 36 1 341 3 bioF 8-amino-7-oxononanoate synthase Anaeromyxobacter sp. (strain K)
B7GHW7 1.54e-63 211 33 2 346 3 bioF Putative 8-amino-7-oxononanoate synthase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q8XZC3 1.9e-63 211 39 6 359 3 bioF 8-amino-7-oxononanoate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A7GSE1 2.11e-63 211 31 3 375 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A1KVF6 2.15e-63 210 36 6 341 3 bioF Putative 8-amino-7-oxononanoate synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A1ITK1 2.2e-63 210 35 6 349 3 bioF Putative 8-amino-7-oxononanoate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M251 2.2e-63 210 35 6 349 3 bioF Putative 8-amino-7-oxononanoate synthase Neisseria meningitidis serogroup C (strain 053442)
Q81V80 2.57e-63 211 33 5 372 3 BA_0620 Putative pyridoxal phosphate-dependent acyltransferase Bacillus anthracis
Q9K0U0 1.01e-62 208 35 6 341 3 bioF Putative 8-amino-7-oxononanoate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q6HE48 1.04e-62 209 30 3 379 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
A5FZN8 1.18e-62 208 36 6 381 3 bioF Putative 8-amino-7-oxononanoate synthase Acidiphilium cryptum (strain JF-5)
B0JQZ0 1.2e-62 208 33 4 362 3 bioF Putative 8-amino-7-oxononanoate synthase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q73KM3 1.35e-62 209 32 5 369 3 TDE_2194 8-amino-7-oxononanoate synthase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
A7HG96 1.5e-62 209 36 2 365 3 bioF 8-amino-7-oxononanoate synthase Anaeromyxobacter sp. (strain Fw109-5)
B2IH50 1.6e-62 208 38 5 348 3 Bind_0814 8-amino-7-oxononanoate synthase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A5UJ44 3.36e-62 207 35 7 356 3 bioF Putative 8-amino-7-oxononanoate synthase Haemophilus influenzae (strain PittGG)
Q4QKR3 3.36e-62 207 35 7 356 3 bioF Putative 8-amino-7-oxononanoate synthase Haemophilus influenzae (strain 86-028NP)
B7JLX2 3.6e-62 207 30 3 379 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus cereus (strain AH820)
Q81MB0 3.6e-62 207 30 3 379 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus anthracis
B4RP93 3.64e-62 207 35 6 341 3 bioF Putative 8-amino-7-oxononanoate synthase Neisseria gonorrhoeae (strain NCCP11945)
O66875 4.38e-62 207 31 6 380 3 bioF Putative 8-amino-7-oxononanoate synthase Aquifex aeolicus (strain VF5)
A0RIB9 5.28e-62 207 30 3 379 3 bioF Putative 8-amino-7-oxononanoate synthase Bacillus thuringiensis (strain Al Hakam)
Q5F6R6 5.63e-62 206 35 6 341 3 bioF Putative 8-amino-7-oxononanoate synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4E9L6 1.18e-61 206 38 5 383 3 bioF 8-amino-7-oxononanoate synthase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A4JIB5 1.54e-61 206 38 5 379 3 bioF 8-amino-7-oxononanoate synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BUV6 2e-61 205 36 9 373 3 GbCGDNIH1_0498 8-amino-7-oxononanoate synthase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
C4LK80 4.44e-61 212 33 4 390 3 bioWF Biotin biosynthesis bifunctional protein BioWF Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
Q0APZ9 9.64e-61 204 38 3 356 3 bioF 8-amino-7-oxononanoate synthase Maricaulis maris (strain MCS10)
Q1BT36 1.07e-60 204 37 6 384 3 bioF 8-amino-7-oxononanoate synthase Burkholderia orbicola (strain AU 1054)
A0KB03 1.07e-60 204 37 6 384 3 bioF 8-amino-7-oxononanoate synthase Burkholderia cenocepacia (strain HI2424)
Q39CE6 1.99e-60 203 38 5 383 3 bioF 8-amino-7-oxononanoate synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B8J637 2.04e-60 203 36 1 341 3 bioF 8-amino-7-oxononanoate synthase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q5SHZ8 2.74e-60 202 35 4 339 1 TTHA1582 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q58694 3.21e-60 202 32 9 374 3 bioF Putative 8-amino-7-oxononanoate synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
B1JZD9 4.3e-60 202 38 5 383 3 bioF 8-amino-7-oxononanoate synthase Burkholderia orbicola (strain MC0-3)
Q7VL09 5.51e-60 201 33 6 388 3 bioF 8-amino-7-oxononanoate synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q2IF62 7.44e-60 201 36 2 352 3 bioF 8-amino-7-oxononanoate synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q119K2 1.08e-59 201 34 6 366 3 bioF Putative 8-amino-7-oxononanoate synthase Trichodesmium erythraeum (strain IMS101)
B8F713 1.33e-59 200 36 5 344 3 bioF Putative 8-amino-7-oxononanoate synthase Glaesserella parasuis serovar 5 (strain SH0165)
Q8DJ97 1.51e-59 201 38 4 336 3 bioF Putative 8-amino-7-oxononanoate synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A9AE46 2.86e-59 200 38 5 383 1 bioF 8-amino-7-oxononanoate synthase Burkholderia multivorans (strain ATCC 17616 / 249)
A9HJ57 5.17e-59 199 35 5 390 3 GDI1920 8-amino-7-oxononanoate synthase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q9K625 1.42e-58 198 35 1 339 3 bioF Putative 8-amino-7-oxononanoate synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B1YNS0 2.3e-58 199 40 4 347 3 bioF 8-amino-7-oxononanoate synthase Burkholderia ambifaria (strain MC40-6)
Q3M9A4 2.37e-58 197 34 5 365 3 bioF Putative 8-amino-7-oxononanoate synthase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P74770 4.11e-58 197 34 7 387 3 bioF Putative 8-amino-7-oxononanoate synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q0BBD6 5.94e-58 199 40 4 347 3 bioF 8-amino-7-oxononanoate synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B0C205 7.47e-58 196 35 4 355 3 bioF Putative 8-amino-7-oxononanoate synthase Acaryochloris marina (strain MBIC 11017)
P08262 1.27e-57 196 34 7 388 3 hemA 5-aminolevulinate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A6UWX3 1.66e-57 195 34 6 343 3 bioF Putative 8-amino-7-oxononanoate synthase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
B1XL23 8.43e-57 193 33 6 383 3 bioF Putative 8-amino-7-oxononanoate synthase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B2FLM5 9.16e-57 194 39 3 345 3 bioF 8-amino-7-oxononanoate synthase Stenotrophomonas maltophilia (strain K279a)
B7K0L9 1.59e-56 192 29 6 384 3 bioF Putative 8-amino-7-oxononanoate synthase Rippkaea orientalis (strain PCC 8801 / RF-1)
B8GVE2 1.66e-56 192 37 6 374 3 bioF Putative 8-amino-7-oxononanoate synthase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A7Z1 1.66e-56 192 37 6 374 3 bioF Putative 8-amino-7-oxononanoate synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B4SM82 2.01e-56 193 39 3 345 3 bioF 8-amino-7-oxononanoate synthase Stenotrophomonas maltophilia (strain R551-3)
Q7NNL4 2.4e-56 192 34 3 346 3 bioF Putative 8-amino-7-oxononanoate synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A7BFV7 2.71e-56 192 29 2 352 1 spt Serine palmitoyltransferase Sphingobacterium spiritivorum
B2J1W1 5.37e-56 191 34 5 361 3 bioF Putative 8-amino-7-oxononanoate synthase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
P26505 5.75e-56 192 33 4 339 3 hemA 5-aminolevulinate synthase Rhizobium radiobacter
B7KD70 7.23e-56 191 32 5 368 3 bioF Putative 8-amino-7-oxononanoate synthase Gloeothece citriformis (strain PCC 7424)
Q0P5L8 1.65e-55 191 30 4 379 1 GCAT 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial Bos taurus
B8ERL9 1.68e-55 189 38 5 338 3 Msil_2132 8-amino-7-oxononanoate synthase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A9W106 2.4e-55 189 34 4 362 3 Mext_0857 8-amino-7-oxononanoate synthase Methylorubrum extorquens (strain PA1)
B7L0L2 2.9e-55 189 34 4 362 3 Mchl_0816 8-amino-7-oxononanoate synthase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
O88986 3.19e-55 190 31 5 377 1 Gcat 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial Mus musculus
A6UQL9 5.86e-55 188 33 9 368 3 bioF Putative 8-amino-7-oxononanoate synthase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q7W9I4 5.94e-55 189 35 4 354 3 bioF Putative 8-amino-7-oxononanoate synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7VWP1 8.51e-55 188 35 5 369 3 bioF Putative 8-amino-7-oxononanoate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q6A6M4 9.89e-55 194 33 5 390 3 PPA1866 Biotin biosynthesis bifunctional protein BioWF Cutibacterium acnes (strain DSM 16379 / KPA171202)
A0QX65 1.87e-54 187 37 8 338 1 bioF 8-amino-7-oxononanoate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8YZT3 2.32e-54 187 34 5 368 3 bioF Putative 8-amino-7-oxononanoate synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A7LXM2 3.3e-54 187 30 2 346 3 spt Serine palmitoyltransferase Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153)
D4H9Y2 4.2e-54 192 33 5 390 3 HMPREF0675_4919 Biotin biosynthesis bifunctional protein BioWF Cutibacterium acnes (strain SK137)
B8IBW2 4.64e-54 186 34 4 366 3 Mnod_6357 8-amino-7-oxononanoate synthase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A0L3L7 1.78e-53 185 32 4 364 3 bioF Putative 8-amino-7-oxononanoate synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B8HTV6 3.5e-53 184 33 5 360 3 bioF Putative 8-amino-7-oxononanoate synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q7WH76 3.69e-53 184 35 4 354 3 bioF Putative 8-amino-7-oxononanoate synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8GW43 4.22e-53 186 32 6 359 1 BIOF 8-amino-7-oxononanoate synthase Arabidopsis thaliana
Q04512 6.8e-53 184 30 5 391 3 hemA 5-aminolevulinate synthase 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
O75600 7.91e-53 184 29 5 380 1 GCAT 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial Homo sapiens
B1Z7Y8 1.09e-52 182 34 5 356 3 Mpop_0781 8-amino-7-oxononanoate synthase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A7BFV6 1.13e-52 183 28 2 352 1 spt Serine palmitoyltransferase Sphingobacterium multivorum
B8J3V0 2.66e-52 181 31 3 366 3 bioF Putative 8-amino-7-oxononanoate synthase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B3QLR6 5.52e-52 181 31 5 350 3 Cpar_2015 8-amino-7-oxononanoate synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
P08080 1.38e-51 180 32 4 344 3 hemA 5-aminolevulinate synthase Rhizobium meliloti (strain 1021)
Q8A9E5 1.64e-51 179 30 2 346 1 spt Serine palmitoyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A0A0H3C7E9 1.79e-51 180 29 2 346 1 spt Serine palmitoyltransferase Caulobacter vibrioides (strain NA1000 / CB15N)
A4T9L3 2.77e-51 179 34 8 352 3 Mflv_3628 8-amino-7-oxononanoate synthase Mycolicibacterium gilvum (strain PYR-GCK)
B1LYP9 3.65e-51 178 37 4 337 3 Mrad2831_0866 8-amino-7-oxononanoate synthase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A3Q146 5.13e-51 178 32 7 376 3 Mjls_3094 8-amino-7-oxononanoate synthase Mycobacterium sp. (strain JLS)
Q1B7F0 7.35e-51 177 32 7 376 3 Mmcs_3077 8-amino-7-oxononanoate synthase Mycobacterium sp. (strain MCS)
A1UHM3 7.35e-51 177 32 7 376 3 Mkms_3137 8-amino-7-oxononanoate synthase Mycobacterium sp. (strain KMS)
A1T8U6 1.13e-50 177 37 8 338 3 Mvan_2789 8-amino-7-oxononanoate synthase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q1RIV2 1.46e-49 175 29 7 382 3 hemA 5-aminolevulinate synthase Rickettsia bellii (strain RML369-C)
P18079 4.46e-49 174 31 5 341 1 hemA 5-aminolevulinate synthase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
B4RFX5 6.19e-49 172 37 5 344 3 bioF Putative 8-amino-7-oxononanoate synthase Phenylobacterium zucineum (strain HLK1)
Q5W264 2.4e-48 176 31 3 336 1 pigH 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH Serratia sp. (strain ATCC 39006)
B0UKC8 3.21e-48 171 34 3 361 3 M446_5168 8-amino-7-oxononanoate synthase Methylobacterium sp. (strain 4-46)
P43089 8.66e-48 170 28 7 402 3 hemA 5-aminolevulinate synthase Paracoccus denitrificans (strain Pd 1222)
Q4UJV4 4.94e-47 168 30 7 347 3 hemA 5-aminolevulinate synthase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q06965 5.69e-47 168 30 8 393 3 hemT 5-aminolevulinate synthase 2 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q93UV0 9.96e-47 167 29 3 350 1 spt Serine palmitoyltransferase Sphingomonas paucimobilis
P13195 1.97e-46 171 30 10 395 2 Alas1 5-aminolevulinate synthase, non-specific, mitochondrial Rattus norvegicus
P9WQ85 2.58e-46 172 32 1 337 1 bioF2 Putative 8-amino-7-oxononanoate synthase 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ84 2.58e-46 172 32 1 337 3 bioF2 Putative 8-amino-7-oxononanoate synthase 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P22557 1.49e-45 168 32 7 343 1 ALAS2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Homo sapiens
Q92G23 1.87e-45 164 30 6 339 3 hemA 5-aminolevulinate synthase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9XT75 1.9e-45 167 32 7 343 2 ALAS2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Delphinapterus leucas
O94069 2.05e-45 167 27 8 408 3 HEM1 5-aminolevulinate synthase, mitochondrial Candida albicans (strain SC5314 / ATCC MYA-2876)
Q3ZC31 2.43e-45 167 32 7 343 2 ALAS2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Bos taurus
Q5R557 2.67e-45 167 32 7 343 2 ALAS2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Pongo abelii
A6QLI6 4.56e-44 164 29 10 397 2 ALAS1 5-aminolevulinate synthase, non-specific, mitochondrial Bos taurus
Q8VC19 9.76e-44 164 30 10 395 1 Alas1 5-aminolevulinate synthase, non-specific, mitochondrial Mus musculus
Q9XS79 1.09e-43 163 30 11 398 2 ALAS1 5-aminolevulinate synthase, non-specific, mitochondrial Delphinapterus leucas
P08680 1.15e-43 162 32 7 343 1 Alas2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Mus musculus
Q63147 1.97e-43 162 32 7 343 1 Alas2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Rattus norvegicus
C8V1D1 1.98e-43 159 30 9 392 2 bioF 8-amino-7-oxononanoate synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0PP02 2.94e-43 157 33 6 324 3 MUL_1560 8-amino-7-oxononanoate synthase Mycobacterium ulcerans (strain Agy99)
Q6BX71 8.99e-43 160 26 7 408 3 HEM1 5-aminolevulinate synthase, mitochondrial Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q740R7 2.24e-42 155 34 6 333 3 MAP_1275 8-amino-7-oxononanoate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P38092 3.17e-42 159 29 7 378 3 hemA 5-aminolevulinate synthase, mitochondrial Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P13196 3.59e-42 159 30 10 383 1 ALAS1 5-aminolevulinate synthase, non-specific, mitochondrial Homo sapiens
Q5R9R9 3.96e-42 159 30 10 383 2 ALAS1 5-aminolevulinate synthase, non-specific, mitochondrial Pongo abelii
A0QHJ9 4.88e-42 154 34 7 336 3 MAV_3205 8-amino-7-oxononanoate synthase Mycobacterium avium (strain 104)
P43090 9.08e-42 157 27 9 395 2 alas2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Opsanus tau
Q6FXE3 2.5e-41 155 28 7 379 3 HEM1 5-aminolevulinate synthase, mitochondrial Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
P45487 3.31e-41 152 34 5 325 3 ML1217 8-amino-7-oxononanoate synthase Mycobacterium leprae (strain TN)
B8ZR84 3.31e-41 152 34 5 325 3 MLBr01217 8-amino-7-oxononanoate synthase Mycobacterium leprae (strain Br4923)
P78698 6.52e-41 155 27 8 399 3 HEM1 5-aminolevulinate synthase, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
P09950 1.21e-40 154 28 7 376 1 HEM1 5-aminolevulinate synthase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B2HQ90 1.89e-40 150 34 5 323 3 MMAR_2384 8-amino-7-oxononanoate synthase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q68VS3 3.08e-40 150 30 6 344 3 hemA 5-aminolevulinate synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZCB8 7.49e-40 149 30 6 344 3 hemA 5-aminolevulinate synthase Rickettsia prowazekii (strain Madrid E)
P43091 8.24e-40 152 29 10 395 2 alas1 5-aminolevulinate synthase, non-specific, mitochondrial Opsanus tau
Q9YHT4 1.09e-39 152 30 8 341 2 alas2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Danio rerio
Q92403 2.19e-39 151 28 9 391 2 hem1 5-aminolevulinate synthase, mitochondrial Agaricus bisporus
P07997 4.38e-39 150 30 9 372 1 ALAS1 5-aminolevulinate synthase, non-specific, mitochondrial Gallus gallus
Q54EX5 2.61e-38 146 27 6 353 1 sptB Serine palmitoyltransferase 2 Dictyostelium discoideum
Q75DX7 4.38e-38 147 27 6 359 3 HEM1 5-aminolevulinate synthase, mitochondrial Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
O14092 5.15e-38 147 28 6 351 3 hem1 5-aminolevulinate synthase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A5WMQ5 9.74e-38 143 32 6 325 3 TBFG_11601 8-amino-7-oxononanoate synthase Mycobacterium tuberculosis (strain F11)
A5U2S6 9.74e-38 143 32 6 325 3 MRA_1581 8-amino-7-oxononanoate synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KJ00 9.74e-38 143 32 6 325 3 BCG_1622 8-amino-7-oxononanoate synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A4X5 9.74e-38 143 32 6 325 3 BQ2027_MB1596 8-amino-7-oxononanoate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQ87 9.74e-38 143 32 6 325 1 bioF1 8-amino-7-oxononanoate synthase 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ86 9.74e-38 143 32 6 325 3 bioF1 8-amino-7-oxononanoate synthase 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q5JK39 3.07e-37 144 27 8 377 2 Os01g0928800 Long chain base biosynthesis protein 2d Oryza sativa subsp. japonica
Q9KM65 4.68e-37 141 26 5 356 1 cqsA CAI-1 autoinducer synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9M304 5.3e-37 143 25 6 381 1 LCB2b Long chain base biosynthesis protein 2b Arabidopsis thaliana
Q8RYL0 7.15e-37 142 27 8 377 3 Os01g0928700 Long chain base biosynthesis protein 2c Oryza sativa subsp. japonica
O54694 1.07e-36 143 27 7 355 2 SPTLC2 Serine palmitoyltransferase 2 Cricetulus griseus
Q9LSZ9 1.34e-36 142 26 6 369 1 LCB2a Long chain base biosynthesis protein 2a Arabidopsis thaliana
Q7RVY5 1.57e-36 143 28 5 346 3 alv-1 5-aminolevulinate synthase, mitochondrial Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q09925 2.57e-36 142 26 10 408 3 lcb2 Serine palmitoyltransferase 2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q2R3K3 2.87e-36 141 26 6 376 2 Os11g0516000 Long chain base biosynthesis protein 2a Oryza sativa subsp. japonica
O15270 5.17e-36 141 27 7 355 1 SPTLC2 Serine palmitoyltransferase 2 Homo sapiens
P97363 5.88e-36 141 27 7 355 1 Sptlc2 Serine palmitoyltransferase 2 Mus musculus
Q9NUV7 6e-36 141 26 6 358 1 SPTLC3 Serine palmitoyltransferase 3 Homo sapiens
Q8RYL1 1.23e-35 139 26 7 376 2 Os01g0928600 Long chain base biosynthesis protein 2b Oryza sativa subsp. japonica
O25320 1.4e-35 137 30 7 336 3 HP_0598 8-amino-7-oxononanoate synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q3B7D2 2.11e-35 139 27 7 355 1 Sptlc2 Serine palmitoyltransferase 2 Rattus norvegicus
Q6CCW0 3.2e-35 139 23 5 392 3 HEM1 5-aminolevulinate synthase, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
Q9ZLN3 9.32e-35 134 30 8 336 3 jhp_0545 8-amino-7-oxononanoate synthase Helicobacter pylori (strain J99 / ATCC 700824)
Q9XVI6 9.88e-35 137 27 8 356 3 sptl-3 Serine palmitoyltransferase 3 Caenorhabditis elegans
Q8BG54 7.87e-34 135 26 8 359 2 Sptlc3 Serine palmitoyltransferase 3 Mus musculus
P40970 1.21e-32 132 26 9 383 1 LCB2 Serine palmitoyltransferase 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q55FL5 1.28e-31 128 26 8 343 3 sptA Serine palmitoyltransferase 1 Dictyostelium discoideum
P48241 2.68e-31 128 25 6 365 3 LCB2 Serine palmitoyltransferase 2 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q20375 2.76e-31 128 28 10 363 3 sptl-2 Serine palmitoyltransferase 2 Caenorhabditis elegans
Q94IB8 1.07e-29 122 27 3 284 1 LCB1 Long chain base biosynthesis protein 1 Arabidopsis thaliana
Q7G4P2 7.49e-29 120 27 3 285 2 Os10g0189600 Long chain base biosynthesis protein 1c Oryza sativa subsp. japonica
Q10P01 8.53e-28 117 27 3 285 2 Os03g0252800 Long chain base biosynthesis protein 1a Oryza sativa subsp. japonica
P18080 2.42e-27 116 29 6 328 2 ALAS2 5-aminolevulinate synthase, erythroid-specific, mitochondrial Gallus gallus
Q6K8E7 8.27e-26 111 26 3 284 2 Os02g0806900 Long chain base biosynthesis protein 1b Oryza sativa subsp. japonica
A7N6R9 2e-24 106 23 3 344 1 cqsA CAI-1 autoinducer synthase Vibrio campbellii (strain ATCC BAA-1116)
P25045 6.38e-23 103 26 4 268 1 LCB1 Serine palmitoyltransferase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O59682 6.58e-21 97 21 5 267 3 lcb1 Serine palmitoyltransferase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P91079 2.25e-19 92 22 6 348 3 sptl-1 Serine palmitoyltransferase 1 Caenorhabditis elegans
A0A3G9HHK2 4.26e-18 89 25 15 375 3 ALT4 Aminotransferase ALT4 Alternaria alternata
O35704 2.41e-17 87 24 5 294 1 Sptlc1 Serine palmitoyltransferase 1 Mus musculus
D4A2H2 3.33e-17 86 24 5 294 1 Sptlc1 Serine palmitoyltransferase 1 Rattus norvegicus
O15269 4.77e-17 85 23 4 268 1 SPTLC1 Serine palmitoyltransferase 1 Homo sapiens
O54695 5.18e-17 85 23 4 267 1 SPTLC1 Serine palmitoyltransferase 1 Cricetulus griseus
Q5R9T5 1.6e-16 84 22 4 267 2 SPTLC1 Serine palmitoyltransferase 1 Pongo abelii
Q60HD1 1.91e-16 84 22 4 251 2 SPTLC1 Serine palmitoyltransferase 1 Macaca fascicularis
Q3MHG1 8.05e-16 82 22 1 202 2 SPTLC1 Serine palmitoyltransferase 1 Bos taurus
Q5WB66 0.001 44 26 10 213 3 glyA Serine hydroxymethyltransferase Shouchella clausii (strain KSM-K16)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02975
Feature type CDS
Gene bioF
Product 8-amino-7-oxononanoate synthase
Location 656111 - 657274 (strand: 1)
Length 1164 (nucleotides) / 387 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_294
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00155 Aminotransferase class I and II

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0156 Coenzyme transport and metabolism (H) H 7-keto-8-aminopelargonate synthetase or related enzyme

Kegg Ortholog Annotation(s)

Protein Sequence

MSWQNYLDKRLNERRNTPLWRKRQVIQHSNGRYLTTLSGDKYVNFSGNDYLGISQHPDVIQAWQRGANEYGVGSGGSGHITGFTQAHQQLEQQLADWLGYDHALLFSSGYSANQGVIATLLEKEDAIIADKLCHASLMEAAILSPASLWRFLHNSAPSLSQRLHKTSANKSLVVTEGVFSMDGDKAPLAAMAEISQQHQAWLMVDDAHGIGVLGKEGKGSCHEAGIKPELLIATFGKAFGISGAAVLCNKATAEFFEQYSRHLIYSTSMPPAQAVALHAALKVIKQDDEGREYLQQLISFFRQGVSSLPVTLLPSQTAIQPLIIGDELRCQQLSDYLQREGFWVKAIFPPTVPPHSARLRITLTTRHQISDIAMLIELLHGFFNQNR

Flanking regions ( +/- flanking 50bp)

CAAGCTGTTGCTGAAAAAGACACCGAACAATTTTATAACGCGGCACTGTAATGAGTTGGCAAAACTATCTAGATAAGCGACTTAATGAGCGTAGAAATACGCCATTATGGCGAAAAAGACAGGTGATCCAGCATAGCAATGGACGCTATTTAACCACACTGTCTGGTGATAAATATGTTAATTTTTCTGGTAACGATTATTTAGGGATAAGCCAACATCCTGATGTTATTCAAGCATGGCAACGTGGTGCGAATGAATATGGTGTAGGGAGTGGGGGATCGGGTCATATTACCGGTTTTACACAGGCCCATCAGCAGTTAGAGCAACAACTCGCTGACTGGTTAGGGTACGATCATGCGCTATTATTTTCTTCAGGTTATAGTGCTAATCAAGGTGTTATTGCGACATTACTTGAAAAAGAAGATGCCATCATTGCCGATAAACTTTGTCATGCTTCATTAATGGAAGCGGCTATCTTATCACCGGCGAGTTTATGGCGCTTTTTGCATAATTCTGCGCCATCTCTATCTCAGCGGCTTCATAAAACCTCTGCGAATAAAAGCTTAGTCGTGACAGAAGGGGTTTTTAGCATGGATGGTGATAAAGCGCCATTAGCGGCTATGGCAGAAATAAGTCAACAGCATCAGGCGTGGTTAATGGTTGATGATGCGCATGGTATTGGCGTGTTAGGTAAAGAAGGTAAAGGGAGTTGCCATGAAGCAGGGATTAAACCTGAGTTATTAATAGCGACTTTTGGTAAAGCCTTTGGCATTAGTGGTGCGGCTGTACTGTGTAATAAGGCGACTGCTGAGTTTTTCGAACAATATTCACGTCACTTAATTTATAGTACCTCAATGCCCCCCGCACAAGCCGTTGCTTTACATGCAGCGTTAAAAGTTATTAAACAAGATGATGAAGGACGAGAATATCTTCAACAACTTATTAGCTTTTTCCGTCAAGGTGTCTCATCACTTCCAGTCACATTATTACCTTCACAAACAGCCATTCAACCGTTAATTATTGGTGATGAACTACGCTGTCAACAACTTTCAGACTATTTACAACGTGAAGGTTTCTGGGTAAAAGCGATCTTTCCACCGACTGTACCCCCTCACAGCGCACGTTTACGCATTACTTTAACGACTCGTCACCAAATTTCCGACATTGCGATGTTAATCGAGCTTCTTCATGGTTTCTTCAATCAAAACAGATAAACAGCAGATAGCCCAGTGTTTTAGTAAAGCGGCTAGCCATTATGATCATC