Homologs in group_2197

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16270 FBDBKF_16270 81.4 Morganella morganii S1 coaD pantetheine-phosphate adenylyltransferase
EHELCC_16305 EHELCC_16305 81.4 Morganella morganii S2 coaD pantetheine-phosphate adenylyltransferase
NLDBIP_17035 NLDBIP_17035 81.4 Morganella morganii S4 coaD pantetheine-phosphate adenylyltransferase
LHKJJB_16955 LHKJJB_16955 81.4 Morganella morganii S3 coaD pantetheine-phosphate adenylyltransferase
HKOGLL_16885 HKOGLL_16885 81.4 Morganella morganii S5 coaD pantetheine-phosphate adenylyltransferase
F4V73_RS17320 F4V73_RS17320 82.0 Morganella psychrotolerans coaD pantetheine-phosphate adenylyltransferase

Distribution of the homologs in the orthogroup group_2197

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2197

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8RSX4 7.91e-119 335 100 0 161 3 coaD Phosphopantetheine adenylyltransferase Proteus mirabilis
B4F0X7 7.91e-119 335 100 0 161 3 coaD Phosphopantetheine adenylyltransferase Proteus mirabilis (strain HI4320)
Q7MY37 2.12e-99 285 83 0 160 3 coaD Phosphopantetheine adenylyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A4W515 1.56e-79 235 70 0 158 1 coaD Phosphopantetheine adenylyltransferase Enterobacter sp. (strain 638)
P0A6I8 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Shigella flexneri
Q0SYG2 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Shigella flexneri serotype 5b (strain 8401)
Q31UZ2 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Shigella boydii serotype 4 (strain Sb227)
B2TTU8 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LK71 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B6I3L1 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli (strain SE11)
P0A6I6 3.93e-79 234 68 0 159 1 coaD Phosphopantetheine adenylyltransferase Escherichia coli (strain K12)
B1IZF9 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A696 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli O9:H4 (strain HS)
B1X968 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli (strain K12 / DH10B)
C4ZXM6 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4B8 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli O8 (strain IAI1)
B5YWD2 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6I7 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli O157:H7
B7L747 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli (strain 55989 / EAEC)
A7ZTI5 3.93e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LVJ5 6.79e-79 234 68 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R4V9 2.15e-78 232 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli (strain UTI89 / UPEC)
B7NET8 2.15e-78 232 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FC88 2.15e-78 232 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBH5 2.15e-78 232 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N1T5 2.15e-78 232 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli O81 (strain ED1a)
B7MFJ5 2.15e-78 232 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3YVZ6 2.4e-78 232 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Shigella sonnei (strain Ss046)
B7NPE0 3.51e-78 232 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A8ARM1 4.14e-78 232 68 0 158 3 coaD Phosphopantetheine adenylyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q9XC89 4.88e-78 231 69 0 158 1 coaD Phosphopantetheine adenylyltransferase Klebsiella pneumoniae
A6TFM5 4.88e-78 231 69 0 158 3 coaD Phosphopantetheine adenylyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B1JQW9 8.35e-78 231 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
B2JYN7 8.35e-78 231 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FCT8 8.35e-78 231 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66GD2 8.92e-78 231 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSD3 9.53e-78 231 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Yersinia pestis (strain Pestoides F)
Q1CD06 9.53e-78 231 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R678 9.53e-78 231 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJN9 9.53e-78 231 67 0 159 1 coaD Phosphopantetheine adenylyltransferase Yersinia pestis
Q1C271 9.53e-78 231 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
B7ULI9 1.34e-77 230 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
C5B9D9 4.67e-77 229 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Edwardsiella ictaluri (strain 93-146)
Q329M3 5.38e-77 229 67 0 159 3 coaD Phosphopantetheine adenylyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B2VF71 6.62e-77 229 68 0 158 3 coaD Phosphopantetheine adenylyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q9X980 1.1e-76 228 66 0 159 3 coaD Phosphopantetheine adenylyltransferase Serratia marcescens
B5XTG9 1.22e-76 228 68 0 158 3 coaD Phosphopantetheine adenylyltransferase Klebsiella pneumoniae (strain 342)
A9MKP0 1.54e-76 228 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5EXD9 1.74e-76 228 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella agona (strain SL483)
Q8ZL48 3.5e-76 227 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A1JHR9 6.54e-76 226 66 0 159 3 coaD Phosphopantetheine adenylyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GLE1 7.07e-76 226 65 0 161 3 coaD Phosphopantetheine adenylyltransferase Serratia proteamaculans (strain 568)
B4TZX6 7.63e-76 226 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella schwarzengrund (strain CVM19633)
A9MVM9 7.63e-76 226 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SXD6 7.63e-76 226 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella newport (strain SL254)
B4T9B9 7.63e-76 226 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella heidelberg (strain SL476)
B5RGF3 7.63e-76 226 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5F8 7.63e-76 226 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella enteritidis PT4 (strain P125109)
B5FM58 7.63e-76 226 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella dublin (strain CT_02021853)
C0Q1W7 9.6e-76 226 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella paratyphi C (strain RKS4594)
Q57IA8 9.6e-76 226 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella choleraesuis (strain SC-B67)
Q8Z2H1 1.18e-75 225 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella typhi
B5BI08 1.18e-75 225 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella paratyphi A (strain AKU_12601)
Q5PC10 1.18e-75 225 67 0 158 3 coaD Phosphopantetheine adenylyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q6DAV2 3.57e-74 222 63 0 158 3 coaD Phosphopantetheine adenylyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DIB6 7.18e-73 218 62 0 158 3 coaD Phosphopantetheine adenylyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q8VW75 4.69e-69 209 58 0 158 3 coaD Phosphopantetheine adenylyltransferase Photobacterium damsela subsp. piscicida
Q9I6D1 1.1e-68 208 57 0 158 1 coaD Phosphopantetheine adenylyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02U51 1.1e-68 208 57 0 158 3 coaD Phosphopantetheine adenylyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V2S6 1.1e-68 208 57 0 158 1 coaD Phosphopantetheine adenylyltransferase Pseudomonas aeruginosa (strain LESB58)
B0KN77 1.36e-68 207 57 0 158 3 coaD Phosphopantetheine adenylyltransferase Pseudomonas putida (strain GB-1)
Q2NQU5 1.5e-68 207 60 0 158 3 coaD Phosphopantetheine adenylyltransferase Sodalis glossinidius (strain morsitans)
Q88CQ7 1.88e-68 207 57 0 159 3 coaD Phosphopantetheine adenylyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WAF7 2.79e-68 207 57 0 158 3 coaD Phosphopantetheine adenylyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1J2E9 4.14e-68 206 56 0 158 3 coaD Phosphopantetheine adenylyltransferase Pseudomonas putida (strain W619)
A4STC9 7.99e-68 206 59 0 160 3 coaD Phosphopantetheine adenylyltransferase Aeromonas salmonicida (strain A449)
Q5QUN6 1.47e-67 205 61 1 162 3 coaD Phosphopantetheine adenylyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q1IGF0 1.49e-67 205 56 0 158 3 coaD Phosphopantetheine adenylyltransferase Pseudomonas entomophila (strain L48)
Q88AH3 1.58e-67 205 56 0 158 3 coaD Phosphopantetheine adenylyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZM37 1.76e-67 205 56 0 158 3 coaD Phosphopantetheine adenylyltransferase Pseudomonas syringae pv. syringae (strain B728a)
A7MQ98 1.84e-67 205 63 0 158 3 coaD Phosphopantetheine adenylyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
Q3K569 2.69e-67 204 57 0 158 3 coaD Phosphopantetheine adenylyltransferase Pseudomonas fluorescens (strain Pf0-1)
A3QJB0 4.46e-67 204 60 0 157 3 coaD Phosphopantetheine adenylyltransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
C3K3N4 7.71e-67 203 56 0 158 3 coaD Phosphopantetheine adenylyltransferase Pseudomonas fluorescens (strain SBW25)
Q4K4A7 7.71e-67 203 56 0 158 3 coaD Phosphopantetheine adenylyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A4Y022 1.18e-66 202 57 0 158 3 coaD Phosphopantetheine adenylyltransferase Pseudomonas mendocina (strain ymp)
A0KEN4 4.34e-66 201 57 0 160 3 coaD Phosphopantetheine adenylyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q3IHU4 5.06e-66 201 58 0 159 3 coaD Phosphopantetheine adenylyltransferase Pseudoalteromonas translucida (strain TAC 125)
A0L2N9 7.42e-66 201 59 0 158 3 coaD Phosphopantetheine adenylyltransferase Shewanella sp. (strain ANA-3)
Q0HPJ5 8.75e-66 201 59 0 158 3 coaD Phosphopantetheine adenylyltransferase Shewanella sp. (strain MR-7)
Q0HDB6 8.75e-66 201 59 0 158 3 coaD Phosphopantetheine adenylyltransferase Shewanella sp. (strain MR-4)
Q15ZV3 2.27e-65 199 59 0 158 3 coaD Phosphopantetheine adenylyltransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
C1DIB2 2.56e-65 199 55 0 156 3 coaD Phosphopantetheine adenylyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A4YCB1 3.67e-65 199 58 0 158 3 coaD Phosphopantetheine adenylyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B0TMZ9 3.67e-65 199 58 0 157 3 coaD Phosphopantetheine adenylyltransferase Shewanella halifaxensis (strain HAW-EB4)
B8CVD4 4.47e-65 199 57 0 157 3 coaD Phosphopantetheine adenylyltransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q6LVM8 4.88e-65 199 57 0 158 3 coaD Phosphopantetheine adenylyltransferase Photobacterium profundum (strain SS9)
A1RE18 5.21e-65 199 58 0 158 3 coaD Phosphopantetheine adenylyltransferase Shewanella sp. (strain W3-18-1)
B1KL36 6.86e-65 198 59 0 157 3 coaD Phosphopantetheine adenylyltransferase Shewanella woodyi (strain ATCC 51908 / MS32)
B4S2C7 9.62e-65 198 58 0 161 3 coaD Phosphopantetheine adenylyltransferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A9KWX0 1.77e-64 197 60 0 152 3 coaD Phosphopantetheine adenylyltransferase Shewanella baltica (strain OS195)
A8HA30 1.94e-64 197 58 0 157 3 coaD Phosphopantetheine adenylyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A8FPF5 4.61e-64 196 58 0 155 3 coaD Phosphopantetheine adenylyltransferase Shewanella sediminis (strain HAW-EB3)
Q8E8I0 4.65e-64 196 60 1 152 3 coaD Phosphopantetheine adenylyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0V8I3 6.45e-64 196 58 0 156 1 coaD Phosphopantetheine adenylyltransferase Acinetobacter baumannii (strain AYE)
B2HUN5 6.45e-64 196 58 0 156 1 coaD Phosphopantetheine adenylyltransferase Acinetobacter baumannii (strain ACICU)
A6WUF6 7.04e-64 196 59 0 152 3 coaD Phosphopantetheine adenylyltransferase Shewanella baltica (strain OS185)
B8EDR6 7.04e-64 196 59 0 152 3 coaD Phosphopantetheine adenylyltransferase Shewanella baltica (strain OS223)
Q07W63 8.01e-64 196 57 0 160 3 coaD Phosphopantetheine adenylyltransferase Shewanella frigidimarina (strain NCIMB 400)
A3CYP1 8.77e-64 196 59 0 152 3 coaD Phosphopantetheine adenylyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B0VTH7 1.64e-63 195 58 0 156 1 coaD Phosphopantetheine adenylyltransferase Acinetobacter baumannii (strain SDF)
Q12SS1 1.32e-62 192 56 0 159 3 coaD Phosphopantetheine adenylyltransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B8D8A3 2.72e-62 192 52 1 160 3 coaD Phosphopantetheine adenylyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57643 2.72e-62 192 52 1 160 3 coaD Phosphopantetheine adenylyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8E6 2.72e-62 192 52 1 160 3 coaD Phosphopantetheine adenylyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
C5BLM4 7.06e-62 191 53 0 154 3 coaD Phosphopantetheine adenylyltransferase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q2SN79 1.35e-61 190 52 0 159 3 coaD Phosphopantetheine adenylyltransferase Hahella chejuensis (strain KCTC 2396)
A1U6M5 4.82e-60 186 50 0 157 3 coaD Phosphopantetheine adenylyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q7MPS0 5.3e-60 186 54 0 155 3 coaD Phosphopantetheine adenylyltransferase Vibrio vulnificus (strain YJ016)
Q8DDY6 5.3e-60 186 54 0 155 3 coaD Phosphopantetheine adenylyltransferase Vibrio vulnificus (strain CMCP6)
C4L7W3 1.97e-59 184 53 0 157 3 coaD Phosphopantetheine adenylyltransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
C3LQI4 3.05e-59 184 53 0 155 3 coaD Phosphopantetheine adenylyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KVC4 3.05e-59 184 53 0 155 3 coaD Phosphopantetheine adenylyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F408 3.05e-59 184 53 0 155 3 coaD Phosphopantetheine adenylyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C4K764 3.66e-59 184 53 0 156 3 coaD Phosphopantetheine adenylyltransferase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q6F8K0 5.16e-59 183 55 0 156 3 coaD Phosphopantetheine adenylyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A7MSN5 9.46e-59 182 51 0 158 3 coaD Phosphopantetheine adenylyltransferase Vibrio campbellii (strain ATCC BAA-1116)
B6EPN7 1.61e-58 182 50 0 158 3 coaD Phosphopantetheine adenylyltransferase Aliivibrio salmonicida (strain LFI1238)
Q9Z613 1.88e-57 179 48 1 159 3 coaD Phosphopantetheine adenylyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q60CN9 2.74e-57 179 49 0 158 3 coaD Phosphopantetheine adenylyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q87T80 3.46e-57 179 50 0 158 3 coaD Phosphopantetheine adenylyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q31EA3 1.01e-56 177 50 0 157 3 coaD Phosphopantetheine adenylyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q820N3 2.7e-56 176 49 0 158 3 coaD Phosphopantetheine adenylyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5GZV9 2.76e-56 177 53 0 152 3 coaD Phosphopantetheine adenylyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SIL3 2.76e-56 177 53 0 152 3 coaD Phosphopantetheine adenylyltransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P2V0 2.76e-56 177 53 0 152 3 coaD Phosphopantetheine adenylyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PJK5 9.39e-56 175 52 0 152 3 coaD Phosphopantetheine adenylyltransferase Xanthomonas axonopodis pv. citri (strain 306)
B4SS16 9.48e-56 175 51 0 150 3 coaD Phosphopantetheine adenylyltransferase Stenotrophomonas maltophilia (strain R551-3)
B2FLW4 1.1e-55 175 51 0 150 3 coaD Phosphopantetheine adenylyltransferase Stenotrophomonas maltophilia (strain K279a)
Q3BS23 1.18e-55 175 52 0 152 3 coaD Phosphopantetheine adenylyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q65R52 1.45e-55 174 49 0 157 3 coaD Phosphopantetheine adenylyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9PEP8 1.82e-55 174 49 0 157 3 coaD Phosphopantetheine adenylyltransferase Xylella fastidiosa (strain 9a5c)
Q0ADM4 2.75e-55 174 50 0 155 3 coaD Phosphopantetheine adenylyltransferase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q87EM8 5.09e-55 173 49 0 157 3 coaD Phosphopantetheine adenylyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I7J1 5.09e-55 173 49 0 157 3 coaD Phosphopantetheine adenylyltransferase Xylella fastidiosa (strain M23)
B0U1Z4 7.46e-55 173 48 0 157 3 coaD Phosphopantetheine adenylyltransferase Xylella fastidiosa (strain M12)
Q1H3D2 1.11e-54 172 50 0 155 3 coaD Phosphopantetheine adenylyltransferase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q5E8L9 1.81e-54 172 48 0 159 3 coaD Phosphopantetheine adenylyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
P71154 2.63e-54 171 49 0 154 3 coaD Phosphopantetheine adenylyltransferase Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
Q8Y2E6 6.1e-54 171 45 0 157 3 coaD Phosphopantetheine adenylyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B8GUN6 8.57e-54 170 51 0 159 3 coaD Phosphopantetheine adenylyltransferase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q2Y5F0 1.26e-53 170 45 0 159 3 coaD Phosphopantetheine adenylyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8P857 1.32e-53 170 51 0 152 3 coaD Phosphopantetheine adenylyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UVY5 1.32e-53 170 51 0 152 3 coaD Phosphopantetheine adenylyltransferase Xanthomonas campestris pv. campestris (strain 8004)
B0RRP8 1.45e-53 170 51 0 152 3 coaD Phosphopantetheine adenylyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q1LRQ5 1.46e-53 169 46 0 156 3 coaD Phosphopantetheine adenylyltransferase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8EYP6 2.01e-53 169 46 0 160 3 coaD Phosphopantetheine adenylyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72M66 2.01e-53 169 46 0 160 3 coaD Phosphopantetheine adenylyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q1QTC8 3.7e-53 169 52 0 152 3 coaD Phosphopantetheine adenylyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1K3H4 5e-53 168 47 0 157 3 coaD Phosphopantetheine adenylyltransferase Azoarcus sp. (strain BH72)
Q8R9U9 6.53e-53 168 46 0 156 3 coaD Phosphopantetheine adenylyltransferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q056E9 8.22e-53 167 46 0 160 3 coaD Phosphopantetheine adenylyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04P85 8.22e-53 167 46 0 160 3 coaD Phosphopantetheine adenylyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B7VHL5 8.75e-53 167 48 0 154 3 coaD Phosphopantetheine adenylyltransferase Vibrio atlanticus (strain LGP32)
Q0KEQ3 1.01e-52 167 46 0 156 3 coaD Phosphopantetheine adenylyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B8I385 1.39e-52 167 44 0 156 3 coaD Phosphopantetheine adenylyltransferase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q476G3 1.5e-52 167 46 0 156 3 coaD Phosphopantetheine adenylyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q9CLD4 1.62e-52 167 52 1 155 3 coaD Phosphopantetheine adenylyltransferase Pasteurella multocida (strain Pm70)
B2AGT3 1.63e-52 167 46 0 156 3 coaD Phosphopantetheine adenylyltransferase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q5WYZ4 1.8e-52 167 45 0 161 3 coaD Phosphopantetheine adenylyltransferase Legionella pneumophila (strain Lens)
Q5ZY26 1.8e-52 167 45 0 161 3 coaD Phosphopantetheine adenylyltransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q7VTP4 1.88e-52 167 50 0 142 3 coaD Phosphopantetheine adenylyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W154 1.88e-52 167 50 0 142 3 coaD Phosphopantetheine adenylyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WNU4 1.88e-52 167 50 0 142 3 coaD Phosphopantetheine adenylyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B2UER1 1.95e-52 167 46 0 156 3 coaD Phosphopantetheine adenylyltransferase Ralstonia pickettii (strain 12J)
A9I6L9 2.58e-52 167 48 0 142 3 coaD Phosphopantetheine adenylyltransferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q2KY40 3.71e-52 166 47 0 142 3 coaD Phosphopantetheine adenylyltransferase Bordetella avium (strain 197N)
B5FFG3 6.27e-52 165 47 0 158 3 coaD Phosphopantetheine adenylyltransferase Aliivibrio fischeri (strain MJ11)
Q5X7J6 9.37e-52 165 48 0 147 3 coaD Phosphopantetheine adenylyltransferase Legionella pneumophila (strain Paris)
Q2T1C2 9.51e-52 165 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63XM3 9.51e-52 165 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia pseudomallei (strain K96243)
A3N5J6 9.51e-52 165 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia pseudomallei (strain 668)
Q3JW91 9.51e-52 165 45 0 154 1 coaD Phosphopantetheine adenylyltransferase Burkholderia pseudomallei (strain 1710b)
A3NR92 9.51e-52 165 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia pseudomallei (strain 1106a)
A1UZP1 9.51e-52 165 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia mallei (strain SAVP1)
Q62FB8 9.51e-52 165 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia mallei (strain ATCC 23344)
A2S6B1 9.51e-52 165 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia mallei (strain NCTC 10229)
A3MQB0 9.51e-52 165 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia mallei (strain NCTC 10247)
B1XS68 1.07e-51 165 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B9L9C2 1.31e-51 164 46 0 147 3 coaD Phosphopantetheine adenylyltransferase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
B1ZWG7 1.45e-51 164 45 0 157 3 coaD Phosphopantetheine adenylyltransferase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
A4JI00 1.72e-51 164 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A9AEW9 1.72e-51 164 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia multivorans (strain ATCC 17616 / 249)
Q0BBQ0 1.72e-51 164 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YN57 1.72e-51 164 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia ambifaria (strain MC40-6)
Q3SLS2 1.75e-51 164 47 0 154 3 coaD Phosphopantetheine adenylyltransferase Thiobacillus denitrificans (strain ATCC 25259)
Q5P730 2.79e-51 164 47 0 154 3 coaD Phosphopantetheine adenylyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q929W5 3.55e-51 164 46 1 161 3 coaD Phosphopantetheine adenylyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B8F6N2 4.32e-51 163 46 0 154 3 coaD Phosphopantetheine adenylyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
Q7VGG0 4.59e-51 163 47 0 151 3 coaD Phosphopantetheine adenylyltransferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9K9Q6 4.69e-51 163 44 0 159 3 coaD Phosphopantetheine adenylyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A6T2S8 4.99e-51 163 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Janthinobacterium sp. (strain Marseille)
A4G927 5.14e-51 163 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Herminiimonas arsenicoxydans
B0BQ73 5.41e-51 163 47 0 157 3 coaD Phosphopantetheine adenylyltransferase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A0AKF8 5.44e-51 163 46 1 161 3 coaD Phosphopantetheine adenylyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q491X2 5.84e-51 163 46 0 158 3 coaD Phosphopantetheine adenylyltransferase Blochmanniella pennsylvanica (strain BPEN)
Q4QMR6 6.05e-51 163 50 0 149 3 coaD Phosphopantetheine adenylyltransferase Haemophilus influenzae (strain 86-028NP)
A4T072 7.84e-51 163 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q39CT5 9.13e-51 162 44 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B0K1X4 1.16e-50 162 44 0 156 3 coaD Phosphopantetheine adenylyltransferase Thermoanaerobacter sp. (strain X514)
B0K9Z1 1.16e-50 162 44 0 156 3 coaD Phosphopantetheine adenylyltransferase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A7ZDJ9 1.48e-50 162 49 0 147 3 coaD Phosphopantetheine adenylyltransferase Campylobacter concisus (strain 13826)
Q1BTG1 1.66e-50 162 44 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia orbicola (strain AU 1054)
B1JYQ4 1.66e-50 162 44 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia orbicola (strain MC0-3)
B4EAQ8 1.66e-50 162 44 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0KAN0 1.66e-50 162 44 0 154 3 coaD Phosphopantetheine adenylyltransferase Burkholderia cenocepacia (strain HI2424)
A3N1D7 2.03e-50 161 46 0 157 3 coaD Phosphopantetheine adenylyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0A592 2.08e-50 162 46 1 159 3 coaD Phosphopantetheine adenylyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B3GY20 2.78e-50 161 46 0 157 3 coaD Phosphopantetheine adenylyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B9MRM3 2.8e-50 161 44 0 147 3 coaD Phosphopantetheine adenylyltransferase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q5L0Z6 4.41e-50 161 42 0 159 3 coaD Phosphopantetheine adenylyltransferase Geobacillus kaustophilus (strain HTA426)
B1HPW8 5.86e-50 160 44 0 155 3 coaD Phosphopantetheine adenylyltransferase Lysinibacillus sphaericus (strain C3-41)
B2JCN4 6.84e-50 160 46 0 142 3 coaD Phosphopantetheine adenylyltransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B2SXG0 7.11e-50 160 44 0 154 3 coaD Phosphopantetheine adenylyltransferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q8Y5K7 8.45e-50 160 44 0 154 3 coaD Phosphopantetheine adenylyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DH77 8.45e-50 160 44 0 154 3 coaD Phosphopantetheine adenylyltransferase Listeria monocytogenes serotype 4a (strain HCC23)
Q65JZ9 9.57e-50 160 42 0 160 3 coaD Phosphopantetheine adenylyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q145X7 1.05e-49 160 46 0 142 3 coaD Phosphopantetheine adenylyltransferase Paraburkholderia xenovorans (strain LB400)
P44805 1.39e-49 159 49 0 149 3 coaD Phosphopantetheine adenylyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A4XKE2 1.39e-49 160 43 0 147 3 coaD Phosphopantetheine adenylyltransferase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A7GYG9 2.92e-49 159 48 0 147 3 coaD Phosphopantetheine adenylyltransferase Campylobacter curvus (strain 525.92)
C4L5T1 3.91e-49 158 43 0 157 3 coaD Phosphopantetheine adenylyltransferase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A6TRV0 4.37e-49 158 49 0 153 3 coaD Phosphopantetheine adenylyltransferase Alkaliphilus metalliredigens (strain QYMF)
B9EB42 4.6e-49 158 45 0 157 3 coaD Phosphopantetheine adenylyltransferase Macrococcus caseolyticus (strain JCSC5402)
C4Z0C3 5e-49 158 42 0 156 3 coaD Phosphopantetheine adenylyltransferase Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
A7I1U3 5.3e-49 158 45 0 150 3 coaD Phosphopantetheine adenylyltransferase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A1WZG0 5.67e-49 158 45 1 162 3 coaD Phosphopantetheine adenylyltransferase Halorhodospira halophila (strain DSM 244 / SL1)
Q4L5D8 7.91e-49 157 44 0 159 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus haemolyticus (strain JCSC1435)
B0URI7 8.13e-49 157 48 1 156 3 coaD Phosphopantetheine adenylyltransferase Histophilus somni (strain 2336)
Q71XW2 8.84e-49 157 45 0 146 3 coaD Phosphopantetheine adenylyltransferase Listeria monocytogenes serotype 4b (strain F2365)
C1KX05 8.84e-49 157 45 0 146 3 coaD Phosphopantetheine adenylyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
A6LKD2 9.15e-49 157 43 0 156 3 coaD Phosphopantetheine adenylyltransferase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q0I593 9.17e-49 157 48 1 156 3 coaD Phosphopantetheine adenylyltransferase Histophilus somni (strain 129Pt)
Q2RHB8 9.23e-49 157 45 0 155 3 coaD Phosphopantetheine adenylyltransferase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B3DYW1 1.17e-48 157 44 1 161 3 coaD Phosphopantetheine adenylyltransferase Methylacidiphilum infernorum (isolate V4)
C5D8K3 2.01e-48 157 42 0 159 3 coaD Phosphopantetheine adenylyltransferase Geobacillus sp. (strain WCH70)
A4ILY8 2.19e-48 156 42 0 159 3 coaD Phosphopantetheine adenylyltransferase Geobacillus thermodenitrificans (strain NG80-2)
A6VM51 2.36e-48 156 47 0 149 3 coaD Phosphopantetheine adenylyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B5YK79 2.52e-48 156 44 1 161 3 coaD Phosphopantetheine adenylyltransferase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A5G4G0 2.83e-48 156 44 0 157 3 coaD Phosphopantetheine adenylyltransferase Geotalea uraniireducens (strain Rf4)
Q5N092 3.46e-48 156 47 0 155 3 coaD Phosphopantetheine adenylyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q55235 3.46e-48 156 47 0 155 3 coaD Phosphopantetheine adenylyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A8FCW1 5.3e-48 155 40 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus pumilus (strain SAFR-032)
Q7M9X2 6.65e-48 155 47 0 151 3 coaD Phosphopantetheine adenylyltransferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B9DPV4 7.17e-48 155 43 0 159 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus carnosus (strain TM300)
B1I2E4 8.51e-48 155 45 0 157 3 coaD Phosphopantetheine adenylyltransferase Desulforudis audaxviator (strain MP104C)
A5UHE3 9.73e-48 155 48 0 149 3 coaD Phosphopantetheine adenylyltransferase Haemophilus influenzae (strain PittGG)
B7GGK2 1.16e-47 155 42 0 159 3 coaD Phosphopantetheine adenylyltransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q1J1P5 1.78e-47 155 42 2 159 3 coaD Phosphopantetheine adenylyltransferase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
A9AWY7 2.72e-47 154 44 0 152 3 coaD Phosphopantetheine adenylyltransferase Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
C4XSE1 2.74e-47 154 43 0 155 3 coaD Phosphopantetheine adenylyltransferase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q8XJM7 3.11e-47 154 43 0 154 3 coaD Phosphopantetheine adenylyltransferase Clostridium perfringens (strain 13 / Type A)
Q0TPM5 3.15e-47 154 43 0 154 3 coaD Phosphopantetheine adenylyltransferase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0AZ31 3.27e-47 153 43 0 154 3 coaD Phosphopantetheine adenylyltransferase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B0TGU9 3.75e-47 154 43 0 155 3 coaD Phosphopantetheine adenylyltransferase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A9KNU8 4.67e-47 153 43 1 158 3 coaD Phosphopantetheine adenylyltransferase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A7Z4C5 4.75e-47 153 43 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A5IH08 6.55e-47 153 44 0 161 3 coaD Phosphopantetheine adenylyltransferase Legionella pneumophila (strain Corby)
Q0SS92 6.75e-47 153 43 0 154 3 coaD Phosphopantetheine adenylyltransferase Clostridium perfringens (strain SM101 / Type A)
A5IJ44 6.94e-47 152 46 1 160 3 coaD Phosphopantetheine adenylyltransferase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B1L7W5 8.27e-47 152 46 1 160 3 coaD Phosphopantetheine adenylyltransferase Thermotoga sp. (strain RQ2)
Q9WZK0 8.27e-47 152 46 1 160 1 coaD Phosphopantetheine adenylyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A5UE83 1.04e-46 152 48 0 149 3 coaD Phosphopantetheine adenylyltransferase Haemophilus influenzae (strain PittEE)
Q5SJS9 1.08e-46 152 42 1 157 1 coaD Phosphopantetheine adenylyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72K87 1.08e-46 152 42 1 157 3 coaD Phosphopantetheine adenylyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B4SGQ2 1.23e-46 152 46 1 158 3 coaD Phosphopantetheine adenylyltransferase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q8ER64 1.29e-46 152 40 0 159 3 coaD Phosphopantetheine adenylyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A3DEX9 1.58e-46 152 39 0 155 3 coaD Phosphopantetheine adenylyltransferase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B4UCU5 1.86e-46 152 43 0 160 3 coaD Phosphopantetheine adenylyltransferase Anaeromyxobacter sp. (strain K)
B8J9D7 1.86e-46 152 43 0 160 3 coaD Phosphopantetheine adenylyltransferase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B0CAI3 2.04e-46 152 42 0 156 3 coaD Phosphopantetheine adenylyltransferase Acaryochloris marina (strain MBIC 11017)
A5V280 2.58e-46 151 41 1 160 3 coaD Phosphopantetheine adenylyltransferase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q7VNN7 3.03e-46 151 45 1 161 3 coaD Phosphopantetheine adenylyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B9M4U3 3.06e-46 151 42 0 156 3 coaD Phosphopantetheine adenylyltransferase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A0RPD1 3.32e-46 151 41 0 158 3 coaD Phosphopantetheine adenylyltransferase Campylobacter fetus subsp. fetus (strain 82-40)
A5N7Z7 3.62e-46 151 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E1F8 3.62e-46 151 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Clostridium kluyveri (strain NBRC 12016)
O34797 5.17e-46 150 42 0 158 1 coaD Phosphopantetheine adenylyltransferase Bacillus subtilis (strain 168)
Q6MQ60 5.41e-46 150 43 0 160 3 coaD Phosphopantetheine adenylyltransferase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A5UWI3 5.84e-46 150 43 0 157 3 coaD Phosphopantetheine adenylyltransferase Roseiflexus sp. (strain RS-1)
Q49WP9 6.36e-46 150 44 0 157 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q2IIM3 6.67e-46 150 43 0 160 3 coaD Phosphopantetheine adenylyltransferase Anaeromyxobacter dehalogenans (strain 2CP-C)
A5GT90 7.01e-46 150 43 0 158 3 coaD Phosphopantetheine adenylyltransferase Synechococcus sp. (strain RCC307)
Q03QM5 8.17e-46 150 44 0 154 3 coaD Phosphopantetheine adenylyltransferase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B8FI62 8.26e-46 150 43 0 158 3 coaD Phosphopantetheine adenylyltransferase Desulfatibacillum aliphaticivorans
B1XNE8 8.28e-46 150 45 0 152 3 coaD Phosphopantetheine adenylyltransferase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q8YN70 1.06e-45 150 45 0 147 3 coaD Phosphopantetheine adenylyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B2TJ12 1.14e-45 149 41 0 153 3 coaD Phosphopantetheine adenylyltransferase Clostridium botulinum (strain Eklund 17B / Type B)
B2V4C6 1.14e-45 149 41 0 153 3 coaD Phosphopantetheine adenylyltransferase Clostridium botulinum (strain Alaska E43 / Type E3)
A8MHA0 1.41e-45 149 45 0 154 3 coaD Phosphopantetheine adenylyltransferase Alkaliphilus oremlandii (strain OhILAs)
C1CY24 1.61e-45 149 43 2 155 3 coaD Phosphopantetheine adenylyltransferase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A1BF85 1.81e-45 149 43 1 159 3 coaD Phosphopantetheine adenylyltransferase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
P63820 1.9e-45 149 41 0 154 1 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain MW2)
A8Z1Q8 1.9e-45 149 41 0 154 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GA90 1.9e-45 149 41 0 154 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain MSSA476)
Q6GHW1 1.9e-45 149 41 0 154 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain MRSA252)
P63819 1.9e-45 149 41 0 154 1 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain N315)
P63818 1.9e-45 149 41 0 154 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QFX8 1.9e-45 149 41 0 154 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain Newman)
Q5HGV9 1.9e-45 149 41 0 154 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain COL)
Q2YXA0 1.9e-45 149 41 0 154 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IS11 1.9e-45 149 41 0 154 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain JH9)
Q2FZF5 1.9e-45 149 41 0 154 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHV6 1.9e-45 149 41 0 154 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain USA300)
A6U0U2 1.9e-45 149 41 0 154 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain JH1)
A7X140 1.9e-45 149 41 0 154 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A7HC22 1.96e-45 149 43 0 158 3 coaD Phosphopantetheine adenylyltransferase Anaeromyxobacter sp. (strain Fw109-5)
A4J698 2e-45 149 43 0 155 3 coaD Phosphopantetheine adenylyltransferase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q8KDS9 2.05e-45 149 43 1 162 3 coaD Phosphopantetheine adenylyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B1YIV1 2.17e-45 149 41 0 157 3 coaD Phosphopantetheine adenylyltransferase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A9BAE9 2.59e-45 149 43 0 155 3 coaD Phosphopantetheine adenylyltransferase Prochlorococcus marinus (strain MIT 9211)
A1WBK4 2.97e-45 149 42 0 156 3 coaD Phosphopantetheine adenylyltransferase Acidovorax sp. (strain JS42)
B9MF03 2.97e-45 149 42 0 156 3 coaD Phosphopantetheine adenylyltransferase Acidovorax ebreus (strain TPSY)
B8HPS4 3.1e-45 149 44 0 147 3 coaD Phosphopantetheine adenylyltransferase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A5CX55 3.32e-45 148 37 0 158 3 coaD Phosphopantetheine adenylyltransferase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B3ECH9 3.41e-45 149 44 1 159 3 coaD Phosphopantetheine adenylyltransferase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A7NK79 3.77e-45 148 43 0 157 3 coaD Phosphopantetheine adenylyltransferase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q5WFE8 3.95e-45 148 43 0 151 3 coaD Phosphopantetheine adenylyltransferase Shouchella clausii (strain KSM-K16)
B8E2S1 4.59e-45 148 41 0 155 3 coaD Phosphopantetheine adenylyltransferase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q83EM7 4.6e-45 148 43 1 160 1 coaD Phosphopantetheine adenylyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NB23 4.6e-45 148 43 1 160 3 coaD Phosphopantetheine adenylyltransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KCX4 4.6e-45 148 43 1 160 3 coaD Phosphopantetheine adenylyltransferase Coxiella burnetii (strain Dugway 5J108-111)
B6J216 4.6e-45 148 43 1 160 3 coaD Phosphopantetheine adenylyltransferase Coxiella burnetii (strain CbuG_Q212)
B6J5S3 4.6e-45 148 43 1 160 3 coaD Phosphopantetheine adenylyltransferase Coxiella burnetii (strain CbuK_Q154)
A7GRV8 5.08e-45 148 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A4TE51 5.41e-45 148 44 1 159 3 coaD Phosphopantetheine adenylyltransferase Mycolicibacterium gilvum (strain PYR-GCK)
B5YEA6 6.52e-45 148 41 0 156 3 coaD Phosphopantetheine adenylyltransferase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B9L2B5 7.06e-45 148 48 1 161 3 coaD Phosphopantetheine adenylyltransferase Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Q8CSZ5 7.16e-45 147 41 0 158 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQ42 7.16e-45 147 41 0 158 3 coaD Phosphopantetheine adenylyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8D2R5 7.77e-45 147 42 1 151 3 coaD Phosphopantetheine adenylyltransferase Wigglesworthia glossinidia brevipalpis
Q5HV25 8.31e-45 147 44 0 144 3 coaD Phosphopantetheine adenylyltransferase Campylobacter jejuni (strain RM1221)
A1VZB5 8.31e-45 147 44 0 144 3 coaD Phosphopantetheine adenylyltransferase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PPF2 8.31e-45 147 44 0 144 3 coaD Phosphopantetheine adenylyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H475 8.31e-45 147 44 0 144 3 coaD Phosphopantetheine adenylyltransferase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FLI0 8.31e-45 147 44 0 144 3 coaD Phosphopantetheine adenylyltransferase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q3AC43 8.42e-45 147 41 0 156 3 coaD Phosphopantetheine adenylyltransferase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q819P1 2.61e-44 146 41 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H6R5 2.61e-44 146 41 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus cereus (strain B4264)
B7IVG6 2.61e-44 146 41 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus cereus (strain G9842)
Q6HEN5 2.64e-44 146 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q635Z7 2.64e-44 146 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus cereus (strain ZK / E33L)
B9IW07 2.64e-44 146 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus cereus (strain Q1)
B7HMA9 2.64e-44 146 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus cereus (strain AH187)
C1EPU3 2.64e-44 146 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus cereus (strain 03BB102)
Q732D8 2.64e-44 146 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JK17 2.64e-44 146 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus cereus (strain AH820)
Q81W43 2.64e-44 146 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus anthracis
A0RHU9 2.64e-44 146 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus thuringiensis (strain Al Hakam)
C3LHZ4 2.64e-44 146 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P6T7 2.64e-44 146 42 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus anthracis (strain A0248)
Q5YS03 3.05e-44 146 43 1 157 3 coaD Phosphopantetheine adenylyltransferase Nocardia farcinica (strain IFM 10152)
A5GL79 3.09e-44 146 45 0 148 3 coaD Phosphopantetheine adenylyltransferase Synechococcus sp. (strain WH7803)
B2A2L7 3.18e-44 146 40 0 152 3 coaD Phosphopantetheine adenylyltransferase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
C4Z9Y1 3.6e-44 145 47 0 144 3 coaD Phosphopantetheine adenylyltransferase Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
C6DZ58 3.8e-44 145 40 0 154 3 coaD Phosphopantetheine adenylyltransferase Geobacter sp. (strain M21)
A9VU91 4.31e-44 145 41 0 158 3 coaD Phosphopantetheine adenylyltransferase Bacillus mycoides (strain KBAB4)
Q115H2 6.09e-44 145 45 0 147 3 coaD Phosphopantetheine adenylyltransferase Trichodesmium erythraeum (strain IMS101)
Q3B3M9 7.83e-44 145 45 1 158 3 coaD Phosphopantetheine adenylyltransferase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B5EB44 1.22e-43 144 40 0 150 3 coaD Phosphopantetheine adenylyltransferase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q895N8 1.41e-43 144 41 0 155 3 coaD Phosphopantetheine adenylyltransferase Clostridium tetani (strain Massachusetts / E88)
C6BXG1 1.55e-43 144 42 0 154 3 coaD Phosphopantetheine adenylyltransferase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B3QNZ9 1.56e-43 144 41 1 162 3 coaD Phosphopantetheine adenylyltransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q2RTK2 1.93e-43 144 41 1 158 3 coaD Phosphopantetheine adenylyltransferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q3AQM9 2.18e-43 144 43 2 159 3 coaD Phosphopantetheine adenylyltransferase Chlorobium chlorochromatii (strain CaD3)
Q7NMB9 2.98e-43 143 46 0 144 3 coaD Phosphopantetheine adenylyltransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A1T732 3.44e-43 143 46 1 157 3 coaD Phosphopantetheine adenylyltransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q55435 3.57e-43 143 44 0 143 3 coaD Phosphopantetheine adenylyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8DJQ7 4.15e-43 143 44 0 147 3 coaD Phosphopantetheine adenylyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B2J6C6 4.57e-43 144 42 0 152 3 coaD Phosphopantetheine adenylyltransferase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B7KEW8 5.43e-43 142 44 0 147 3 coaD Phosphopantetheine adenylyltransferase Gloeothece citriformis (strain PCC 7424)
B0SJR1 5.5e-43 143 38 0 158 3 coaD Phosphopantetheine adenylyltransferase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0S9J5 5.5e-43 143 38 0 158 3 coaD Phosphopantetheine adenylyltransferase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A1SR02 5.67e-43 143 41 0 152 3 coaD Phosphopantetheine adenylyltransferase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B3EQL4 6.4e-43 143 44 2 158 3 coaD Phosphopantetheine adenylyltransferase Chlorobium phaeobacteroides (strain BS1)
Q6AJH7 7.76e-43 142 45 1 155 3 coaD Phosphopantetheine adenylyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q3AXV0 8.54e-43 142 45 0 148 3 coaD Phosphopantetheine adenylyltransferase Synechococcus sp. (strain CC9902)
A0LV90 1.23e-42 142 43 1 155 3 coaD Phosphopantetheine adenylyltransferase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A8F4E1 1.29e-42 142 38 1 160 3 coaD Phosphopantetheine adenylyltransferase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
A4X4F2 1.32e-42 142 43 1 155 3 coaD Phosphopantetheine adenylyltransferase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A8ZXR7 1.52e-42 142 41 0 155 3 coaD Phosphopantetheine adenylyltransferase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q97IB2 1.58e-42 142 42 0 153 3 coaD Phosphopantetheine adenylyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A0QV16 1.72e-42 141 44 1 154 3 coaD Phosphopantetheine adenylyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q1MRN8 1.76e-42 142 41 2 155 3 coaD Phosphopantetheine adenylyltransferase Lawsonia intracellularis (strain PHE/MN1-00)
Q39UT4 2.11e-42 141 38 0 159 3 coaD Phosphopantetheine adenylyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A0PQ17 2.12e-42 141 47 1 146 3 coaD Phosphopantetheine adenylyltransferase Mycobacterium ulcerans (strain Agy99)
B2HIK6 2.12e-42 141 47 1 146 3 coaD Phosphopantetheine adenylyltransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q831P9 2.86e-42 141 42 1 158 1 coaD Phosphopantetheine adenylyltransferase Enterococcus faecalis (strain ATCC 700802 / V583)
P9WPA5 3.35e-42 140 46 1 154 1 coaD Phosphopantetheine adenylyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPA4 3.35e-42 140 46 1 154 3 coaD Phosphopantetheine adenylyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U6X4 3.35e-42 140 46 1 154 3 coaD Phosphopantetheine adenylyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AG80 3.35e-42 140 46 1 154 3 coaD Phosphopantetheine adenylyltransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KMV9 3.35e-42 140 46 1 154 3 coaD Phosphopantetheine adenylyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A531 3.35e-42 140 46 1 154 3 coaD Phosphopantetheine adenylyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B1VYY6 4.83e-42 140 41 1 158 3 coaD Phosphopantetheine adenylyltransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q73VL1 5.43e-42 140 43 1 157 3 coaD Phosphopantetheine adenylyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QJ93 5.43e-42 140 43 1 157 3 coaD Phosphopantetheine adenylyltransferase Mycobacterium avium (strain 104)
A8G4U2 5.59e-42 140 40 0 147 3 coaD Phosphopantetheine adenylyltransferase Prochlorococcus marinus (strain MIT 9215)
Q67PG9 6.22e-42 140 36 0 157 3 coaD Phosphopantetheine adenylyltransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8FPP9 7.15e-42 140 45 2 155 3 coaD Phosphopantetheine adenylyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B1WS35 7.19e-42 140 43 0 146 3 coaD Phosphopantetheine adenylyltransferase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q1GR20 8.11e-42 140 37 1 158 3 coaD Phosphopantetheine adenylyltransferase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A2C9T2 8.46e-42 139 41 0 148 3 coaD Phosphopantetheine adenylyltransferase Prochlorococcus marinus (strain MIT 9303)
Q3AJW3 9.28e-42 140 43 0 148 3 coaD Phosphopantetheine adenylyltransferase Synechococcus sp. (strain CC9605)
A2BR50 1.1e-41 139 40 0 144 3 coaD Phosphopantetheine adenylyltransferase Prochlorococcus marinus (strain AS9601)
A3PCX3 1.12e-41 139 40 0 147 3 coaD Phosphopantetheine adenylyltransferase Prochlorococcus marinus (strain MIT 9301)
Q7U6T8 1.47e-41 139 43 0 148 3 coaD Phosphopantetheine adenylyltransferase Parasynechococcus marenigrum (strain WH8102)
B3CMX3 1.88e-41 139 39 1 153 3 coaD Phosphopantetheine adenylyltransferase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
B4S8K5 1.9e-41 139 41 2 162 3 coaD Phosphopantetheine adenylyltransferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q9RWM4 1.92e-41 139 38 2 158 3 coaD Phosphopantetheine adenylyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q31AW9 2.57e-41 138 40 0 147 3 coaD Phosphopantetheine adenylyltransferase Prochlorococcus marinus (strain MIT 9312)
B8GVE7 2.61e-41 139 40 1 159 3 coaD Phosphopantetheine adenylyltransferase Caulobacter vibrioides (strain NA1000 / CB15N)
P58103 2.61e-41 139 40 1 159 3 coaD Phosphopantetheine adenylyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B6ISP7 2.73e-41 139 39 1 163 3 coaD Phosphopantetheine adenylyltransferase Rhodospirillum centenum (strain ATCC 51521 / SW)
Q8NQU5 3.14e-41 138 45 2 155 3 coaD Phosphopantetheine adenylyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QDU2 3.14e-41 138 45 2 155 3 coaD Phosphopantetheine adenylyltransferase Corynebacterium glutamicum (strain R)
Q0S2E4 3.53e-41 138 39 1 157 3 coaD Phosphopantetheine adenylyltransferase Rhodococcus jostii (strain RHA1)
Q5LRC9 4.29e-41 138 41 2 161 3 coaD Phosphopantetheine adenylyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A6LSL2 4.46e-41 138 40 0 154 3 coaD Phosphopantetheine adenylyltransferase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q5FKS7 4.78e-41 138 43 1 155 3 coaD Phosphopantetheine adenylyltransferase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q3A423 5.31e-41 138 40 0 157 3 coaD Phosphopantetheine adenylyltransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A1UED2 5.68e-41 137 42 1 156 3 coaD Phosphopantetheine adenylyltransferase Mycobacterium sp. (strain KMS)
A3PXT6 5.68e-41 137 42 1 156 3 coaD Phosphopantetheine adenylyltransferase Mycobacterium sp. (strain JLS)
C1B2Q0 6.64e-41 137 39 1 157 3 coaD Phosphopantetheine adenylyltransferase Rhodococcus opacus (strain B4)
B0JPJ2 6.78e-41 137 40 0 147 3 coaD Phosphopantetheine adenylyltransferase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q4FLZ4 7.17e-41 137 38 1 162 3 coaD Phosphopantetheine adenylyltransferase Pelagibacter ubique (strain HTCC1062)
O26010 7.4e-41 137 42 0 150 1 coaD Phosphopantetheine adenylyltransferase Helicobacter pylori (strain ATCC 700392 / 26695)
Q1CRB7 7.99e-41 137 42 0 150 3 coaD Phosphopantetheine adenylyltransferase Helicobacter pylori (strain HPAG1)
B5Z994 7.99e-41 137 42 0 150 3 coaD Phosphopantetheine adenylyltransferase Helicobacter pylori (strain G27)
B6JNX3 7.99e-41 137 42 0 150 3 coaD Phosphopantetheine adenylyltransferase Helicobacter pylori (strain P12)
Q7V7L9 1.13e-40 137 40 0 148 3 coaD Phosphopantetheine adenylyltransferase Prochlorococcus marinus (strain MIT 9313)
Q0IAF3 1.34e-40 137 41 0 148 3 coaD Phosphopantetheine adenylyltransferase Synechococcus sp. (strain CC9311)
Q11RP5 1.39e-40 136 44 0 147 3 coaD Phosphopantetheine adenylyltransferase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A9BIS4 1.48e-40 137 41 0 146 3 coaD Phosphopantetheine adenylyltransferase Petrotoga mobilis (strain DSM 10674 / SJ95)
Q74DS2 1.52e-40 137 39 0 155 3 coaD Phosphopantetheine adenylyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B2UVM0 1.54e-40 136 42 0 150 3 coaD Phosphopantetheine adenylyltransferase Helicobacter pylori (strain Shi470)
Q1AW92 1.57e-40 137 41 0 154 3 coaD Phosphopantetheine adenylyltransferase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
O69466 1.75e-40 136 43 1 156 3 coaD Phosphopantetheine adenylyltransferase Mycobacterium leprae (strain TN)
Q17V95 2.11e-40 136 42 0 150 3 coaD Phosphopantetheine adenylyltransferase Helicobacter acinonychis (strain Sheeba)
A5FGN1 2.69e-40 135 43 1 148 3 coaD Phosphopantetheine adenylyltransferase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
B0SZS4 2.97e-40 136 40 1 159 3 coaD Phosphopantetheine adenylyltransferase Caulobacter sp. (strain K31)
A0Q101 3.67e-40 135 41 0 143 3 coaD Phosphopantetheine adenylyltransferase Clostridium novyi (strain NT)
C3L0J4 3.79e-40 135 36 0 157 3 coaD Phosphopantetheine adenylyltransferase Clostridium botulinum (strain 657 / Type Ba4)
B1MDL6 3.91e-40 135 42 1 154 1 coaD Phosphopantetheine adenylyltransferase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q7V1I7 3.98e-40 135 39 0 147 3 coaD Phosphopantetheine adenylyltransferase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
C5CFP6 4.06e-40 135 39 0 155 3 coaD Phosphopantetheine adenylyltransferase Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
Q9ZJE4 5.26e-40 135 42 0 150 3 coaD Phosphopantetheine adenylyltransferase Helicobacter pylori (strain J99 / ATCC 700824)
C0ZXQ0 5.74e-40 135 37 1 157 3 coaD Phosphopantetheine adenylyltransferase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
B1KX43 5.86e-40 135 36 0 157 3 coaD Phosphopantetheine adenylyltransferase Clostridium botulinum (strain Loch Maree / Type A3)
A7GG79 5.86e-40 135 36 0 157 3 coaD Phosphopantetheine adenylyltransferase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IIK4 5.86e-40 135 36 0 157 3 coaD Phosphopantetheine adenylyltransferase Clostridium botulinum (strain Okra / Type B1)
A4IZ18 5.9e-40 135 40 1 161 3 coaD Phosphopantetheine adenylyltransferase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NH87 5.9e-40 135 40 1 161 3 coaD Phosphopantetheine adenylyltransferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BL95 5.9e-40 135 40 1 161 3 coaD Phosphopantetheine adenylyltransferase Francisella tularensis subsp. holarctica (strain OSU18)
A0Q5Y0 5.9e-40 135 40 1 161 3 coaD Phosphopantetheine adenylyltransferase Francisella tularensis subsp. novicida (strain U112)
Q2A2Q6 5.9e-40 135 40 1 161 3 coaD Phosphopantetheine adenylyltransferase Francisella tularensis subsp. holarctica (strain LVS)
A7ND27 5.9e-40 135 40 1 161 3 coaD Phosphopantetheine adenylyltransferase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14IN9 5.9e-40 135 40 1 161 3 coaD Phosphopantetheine adenylyltransferase Francisella tularensis subsp. tularensis (strain FSC 198)
C1FSR3 5.93e-40 135 36 0 157 3 coaD Phosphopantetheine adenylyltransferase Clostridium botulinum (strain Kyoto / Type A2)
A5I4S1 5.93e-40 135 36 0 157 3 coaD Phosphopantetheine adenylyltransferase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FW59 5.93e-40 135 36 0 157 3 coaD Phosphopantetheine adenylyltransferase Clostridium botulinum (strain ATCC 19397 / Type A)
A1VDV0 6.19e-40 136 40 0 155 3 coaD Phosphopantetheine adenylyltransferase Nitratidesulfovibrio vulgaris (strain DP4)
Q72BV2 6.19e-40 136 40 0 155 3 coaD Phosphopantetheine adenylyltransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q2LTS1 8.28e-40 135 38 0 157 3 coaD Phosphopantetheine adenylyltransferase Syntrophus aciditrophicus (strain SB)
B0S155 1.02e-39 134 36 0 160 3 coaD Phosphopantetheine adenylyltransferase Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q164T8 1.28e-39 134 38 2 161 3 coaD Phosphopantetheine adenylyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q24XZ0 1.39e-39 134 46 0 153 3 coaD Phosphopantetheine adenylyltransferase Desulfitobacterium hafniense (strain Y51)
Q2JJM6 1.41e-39 134 43 0 146 3 coaD Phosphopantetheine adenylyltransferase Synechococcus sp. (strain JA-2-3B'a(2-13))
O66614 1.45e-39 134 39 1 158 3 coaD Phosphopantetheine adenylyltransferase Aquifex aeolicus (strain VF5)
Q039M3 1.65e-39 134 42 1 159 3 coaD Phosphopantetheine adenylyltransferase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B8FTK5 1.69e-39 134 46 0 153 3 coaD Phosphopantetheine adenylyltransferase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B3WE28 1.72e-39 134 42 1 159 3 coaD Phosphopantetheine adenylyltransferase Lacticaseibacillus casei (strain BL23)
Q2JRG2 1.73e-39 134 41 0 153 3 coaD Phosphopantetheine adenylyltransferase Synechococcus sp. (strain JA-3-3Ab)
Q310R6 2.44e-39 134 38 0 155 3 coaD Phosphopantetheine adenylyltransferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q9RME4 2.48e-39 134 36 1 162 3 coaD Phosphopantetheine adenylyltransferase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B2SHB2 3.37e-39 133 40 1 161 3 coaD Phosphopantetheine adenylyltransferase Francisella tularensis subsp. mediasiatica (strain FSC147)
B0TYA1 3.4e-39 133 40 1 161 3 coaD Phosphopantetheine adenylyltransferase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q73HM7 3.76e-39 133 38 1 153 3 coaD Phosphopantetheine adenylyltransferase Wolbachia pipientis wMel
A6GXD6 4.53e-39 132 42 1 147 3 coaD Phosphopantetheine adenylyltransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q5GRI5 6.87e-39 132 41 1 143 3 coaD Phosphopantetheine adenylyltransferase Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q46L10 7.39e-39 132 37 0 153 3 coaD Phosphopantetheine adenylyltransferase Prochlorococcus marinus (strain NATL2A)
Q9ZBR1 1.23e-38 132 39 1 158 3 coaD Phosphopantetheine adenylyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C0R2K8 1.43e-38 132 37 1 153 3 coaD Phosphopantetheine adenylyltransferase Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q1GHM4 1.88e-38 131 39 1 162 3 coaD Phosphopantetheine adenylyltransferase Ruegeria sp. (strain TM1040)
A5EXY9 2.38e-38 131 42 2 154 3 coaD Phosphopantetheine adenylyltransferase Dichelobacter nodosus (strain VCS1703A)
A8YUR4 2.98e-38 131 41 1 156 3 coaD Phosphopantetheine adenylyltransferase Lactobacillus helveticus (strain DPC 4571)
Q6NHJ8 3.17e-38 130 39 2 156 3 coaD Phosphopantetheine adenylyltransferase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A1SLV0 3.45e-38 130 39 1 156 3 coaD Phosphopantetheine adenylyltransferase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A2BWL2 4.39e-38 130 38 0 147 3 coaD Phosphopantetheine adenylyltransferase Prochlorococcus marinus (strain MIT 9515)
A2C247 5.02e-38 130 35 0 153 3 coaD Phosphopantetheine adenylyltransferase Prochlorococcus marinus (strain NATL1A)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15650
Feature type CDS
Gene coaD
Product pantetheine-phosphate adenylyltransferase
Location 3477579 - 3478064 (strand: -1)
Length 486 (nucleotides) / 161 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2197
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01467 Cytidylyltransferase-like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0669 Coenzyme transport and metabolism (H) H Phosphopantetheine adenylyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00954 pantetheine-phosphate adenylyltransferase [EC:2.7.7.3] Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of cofactors
Coenzyme A biosynthesis, pantothenate => CoA

Protein Sequence

MKNKAIYPGTFDPITYGHIDILTRAAGMFDTVLLAIAASARKNPMFSLEERVALAKEVTQHLPNVEVVGFCELMANFAKKQQATILIRGVRSVSDFEYEWQLANMNRHFAPDLDSVFLLPSQNLSFVSSSLIKDVARHDGDVSTFLPEVVATAMLQKLGKR

Flanking regions ( +/- flanking 50bp)

CTTTAATAAATACGCCTCATTATGGGAACTTAGCCGGAAAAACCGTGAATATGAAAAATAAAGCTATCTACCCTGGAACCTTTGATCCCATCACCTATGGGCATATTGATATTCTCACTCGTGCTGCGGGTATGTTTGACACGGTGTTATTAGCCATTGCTGCCAGCGCCCGTAAAAACCCTATGTTTAGTTTAGAAGAGCGTGTCGCTTTAGCAAAAGAAGTCACCCAACACCTGCCGAATGTGGAAGTTGTCGGCTTTTGTGAGCTAATGGCGAATTTTGCTAAAAAACAGCAAGCGACCATTTTGATCCGTGGCGTACGCTCGGTTTCTGATTTTGAATATGAGTGGCAACTGGCGAATATGAACCGTCATTTTGCCCCAGATCTCGATAGTGTCTTTTTGTTACCTTCACAAAATCTCTCTTTTGTTTCTTCTTCACTGATCAAAGATGTGGCGCGTCATGACGGCGATGTATCGACTTTTTTACCTGAAGTGGTTGCTACAGCAATGCTACAAAAACTCGGTAAGCGTTAATCGGTTATTTCACCATGTTGGCAATGTCGGCAAAAGAAAGTGCTACGTTG