Homologs in group_4437
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P9WKT7 | 3.91e-05 | 40 | 31 | 0 | 48 | 1 | Rv0500A | Putative DNA-binding protein Rv0500A | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| P9WKT6 | 3.91e-05 | 40 | 31 | 0 | 48 | 4 | MT0521 | Putative DNA-binding protein MT0521 | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS15555 |
| Feature type | CDS |
| Gene | - |
| Product | helix-turn-helix domain-containing protein |
| Location | 3461648 - 3461830 (strand: -1) |
| Length | 183 (nucleotides) / 60 (amino acids) |
| In genomic island | GI63 |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_4437 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
MSDEILTLKELADYLKLAEKTTYRLTAEGKLPGFKVGGSWRFRKSDIDSWITKQKNSGYR
ACTCCTCAATTTTCTCATATTCTCGCTTCCTAGAAAATTGAGGGGTTACTATGTCTGATGAAATACTCACACTTAAAGAGCTGGCTGATTATCTCAAGCTAGCTGAAAAGACTACATACAGGTTGACAGCAGAGGGTAAATTACCAGGATTTAAAGTCGGAGGTAGTTGGCGCTTTAGAAAAAGTGACATTGATAGCTGGATAACCAAACAAAAAAATAGTGGGTATCGATAGATTTCTACTATCCTCTGATGTATCTTAACCTCAATAACTGTTTTTATATA
