Homologs in group_1600

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10440 FBDBKF_10440 84.8 Morganella morganii S1 trpS tryptophan--tRNA ligase
EHELCC_14775 EHELCC_14775 84.8 Morganella morganii S2 trpS tryptophan--tRNA ligase
NLDBIP_14605 NLDBIP_14605 84.8 Morganella morganii S4 trpS tryptophan--tRNA ligase
LHKJJB_14740 LHKJJB_14740 84.8 Morganella morganii S3 trpS tryptophan--tRNA ligase
HKOGLL_13360 HKOGLL_13360 84.8 Morganella morganii S5 trpS tryptophan--tRNA ligase
F4V73_RS14135 F4V73_RS14135 84.5 Morganella psychrotolerans trpS tryptophan--tRNA ligase

Distribution of the homologs in the orthogroup group_1600

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1600

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7NA61 0.0 644 89 0 341 3 trpS Tryptophan--tRNA ligase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9EYY6 0.0 602 85 0 332 3 trpS Tryptophan--tRNA ligase Klebsiella aerogenes
Q8ZJF2 0.0 597 81 0 342 1 trpS Tryptophan--tRNA ligase Yersinia pestis
P0A2P2 0.0 590 83 0 332 3 trpS Tryptophan--tRNA ligase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2P3 0.0 590 83 0 332 3 trpS Tryptophan--tRNA ligase Salmonella typhi
P67588 0.0 590 83 0 332 3 trpS Tryptophan--tRNA ligase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67589 0.0 590 83 0 332 3 trpS Tryptophan--tRNA ligase Escherichia coli O157:H7
P00954 0.0 589 83 0 332 1 trpS Tryptophan--tRNA ligase Escherichia coli (strain K12)
Q83JA5 0.0 585 82 0 332 3 trpS Tryptophan--tRNA ligase Shigella flexneri
P57956 0.0 569 78 0 330 3 trpS Tryptophan--tRNA ligase Pasteurella multocida (strain Pm70)
P43835 0.0 551 76 0 330 1 trpS Tryptophan--tRNA ligase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8EK12 0.0 524 72 0 329 3 trpS Tryptophan--tRNA ligase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7VPB2 0.0 524 72 1 340 3 trpS Tryptophan--tRNA ligase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9KNV7 5.11e-168 474 66 2 336 1 trpS Tryptophan--tRNA ligase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5E2G5 8.64e-168 473 66 2 336 3 trpS Tryptophan--tRNA ligase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q87L13 1.56e-165 468 65 2 336 3 trpS Tryptophan--tRNA ligase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8DCT6 6.63e-165 466 65 2 336 3 trpS Tryptophan--tRNA ligase Vibrio vulnificus (strain CMCP6)
Q7MH15 1.72e-164 465 65 2 336 3 trpS Tryptophan--tRNA ligase Vibrio vulnificus (strain YJ016)
Q8K941 1.06e-143 412 56 1 329 3 trpS Tryptophan--tRNA ligase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q7VRN5 2.06e-142 409 56 0 328 3 trpS Tryptophan--tRNA ligase Blochmanniella floridana
P57602 2.59e-140 404 54 1 329 3 trpS Tryptophan--tRNA ligase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q891C7 6.64e-132 382 55 1 329 3 trpS Tryptophan--tRNA ligase Clostridium tetani (strain Massachusetts / E88)
Q8R9X8 5.5e-129 374 55 3 326 3 trpS Tryptophan--tRNA ligase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q97LD6 1.03e-127 372 53 2 330 3 trpS Tryptophan--tRNA ligase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8Y577 9.8e-126 366 57 3 328 3 trpS Tryptophan--tRNA ligase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9K8Y2 1.76e-125 365 56 3 328 3 trpS Tryptophan--tRNA ligase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q929H5 3.05e-125 365 57 3 328 3 trpS Tryptophan--tRNA ligase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8CT69 7.44e-125 364 54 2 325 3 trpS Tryptophan--tRNA ligase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P21656 1.08e-124 363 56 3 328 1 trpS Tryptophan--tRNA ligase Bacillus subtilis (strain 168)
Q5HQH4 1.23e-124 363 54 2 325 3 trpS Tryptophan--tRNA ligase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q81TS6 1.55e-124 363 54 3 326 3 trpS Tryptophan--tRNA ligase Bacillus anthracis
Q8ERU2 1.7e-124 363 56 4 326 3 trpS Tryptophan--tRNA ligase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8XMQ5 4.94e-124 362 51 1 330 3 trpS Tryptophan--tRNA ligase Clostridium perfringens (strain 13 / Type A)
P00953 7.2e-124 362 55 3 325 1 trpS Tryptophan--tRNA ligase Geobacillus stearothermophilus
Q71XG7 9.6e-124 361 56 3 328 3 trpS Tryptophan--tRNA ligase Listeria monocytogenes serotype 4b (strain F2365)
P59466 5.7e-122 357 49 0 326 3 trpS Tryptophan--tRNA ligase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8D1X5 8.73e-122 357 52 2 327 3 trpS Tryptophan--tRNA ligase Wigglesworthia glossinidia brevipalpis
Q6GI89 1.2e-120 353 53 2 325 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain MRSA252)
P67594 1.82e-120 353 53 2 325 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain MW2)
Q6GAT0 1.82e-120 353 53 2 325 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain MSSA476)
P67593 1.82e-120 353 53 2 325 1 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain N315)
P67592 1.82e-120 353 53 2 325 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH88 1.82e-120 353 53 2 325 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain COL)
Q82HU1 8.56e-120 352 53 3 333 3 trpS2 Tryptophan--tRNA ligase 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9KZA7 3.24e-119 350 54 3 332 3 trpS2 Tryptophan--tRNA ligase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q7MAE0 5.01e-119 349 52 1 326 3 trpS Tryptophan--tRNA ligase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q8NSJ4 2.62e-118 348 52 3 329 3 trpS Tryptophan--tRNA ligase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8FRR3 5.31e-117 345 51 4 335 3 trpS Tryptophan--tRNA ligase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q7VIP6 4.79e-115 339 48 2 331 3 trpS Tryptophan--tRNA ligase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
P9WFT3 1.93e-113 335 52 3 328 1 trpS Tryptophan--tRNA ligase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFT2 1.93e-113 335 52 3 328 3 trpS Tryptophan--tRNA ligase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67591 1.93e-113 335 52 3 328 3 trpS Tryptophan--tRNA ligase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q6AGQ7 1.14e-112 333 51 3 330 3 trpS Tryptophan--tRNA ligase Leifsonia xyli subsp. xyli (strain CTCB07)
Q830U2 3.72e-110 327 48 4 330 3 trpS Tryptophan--tRNA ligase Enterococcus faecalis (strain ATCC 700802 / V583)
Q49901 5.18e-110 327 50 4 332 3 trpS Tryptophan--tRNA ligase Mycobacterium leprae (strain TN)
P56396 5.01e-109 324 47 3 330 3 trpS Tryptophan--tRNA ligase Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZJX4 1.17e-107 320 47 3 330 3 trpS Tryptophan--tRNA ligase Helicobacter pylori (strain J99 / ATCC 700824)
Q8DHG3 1.58e-102 307 49 3 330 3 trpS Tryptophan--tRNA ligase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q7TV34 2.68e-100 302 47 4 337 3 trpS Tryptophan--tRNA ligase Prochlorococcus marinus (strain MIT 9313)
Q7V286 6.19e-100 301 45 3 329 3 trpS Tryptophan--tRNA ligase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q83FN1 1.42e-99 300 46 4 338 3 trpS Tryptophan--tRNA ligase Tropheryma whipplei (strain Twist)
Q7VBM9 1.46e-99 300 46 2 334 3 trpS Tryptophan--tRNA ligase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q83HC3 1.86e-99 300 46 4 338 3 trpS Tryptophan--tRNA ligase Tropheryma whipplei (strain TW08/27)
Q7NCG8 2.52e-99 299 46 2 326 3 trpS Tryptophan--tRNA ligase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q9AC05 9.38e-98 296 46 1 332 3 trpS Tryptophan--tRNA ligase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q82E91 1.19e-97 295 45 4 330 3 trpS1 Tryptophan--tRNA ligase 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P67587 1.44e-97 295 42 1 349 3 trpS Tryptophan--tRNA ligase Brucella suis biovar 1 (strain 1330)
P67586 1.44e-97 295 42 1 349 3 trpS Tryptophan--tRNA ligase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8CJX0 3.08e-97 294 47 4 330 3 trpS1 Tryptophan--tRNA ligase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q7TTU9 1.24e-96 293 46 4 335 3 trpS Tryptophan--tRNA ligase Parasynechococcus marenigrum (strain WH8102)
Q8YXE4 4.98e-96 291 46 2 330 3 trpS Tryptophan--tRNA ligase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q89W91 1.41e-95 290 44 2 341 3 trpS Tryptophan--tRNA ligase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q92HR1 2.44e-95 289 44 2 330 3 trpS Tryptophan--tRNA ligase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q4UL98 2.01e-94 286 44 2 330 3 trpS Tryptophan--tRNA ligase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P73655 3.56e-94 286 45 2 336 3 trpS Tryptophan--tRNA ligase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q98PH7 1.97e-93 284 46 6 335 3 trpS Tryptophan--tRNA ligase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q92SI9 3.1e-92 282 42 3 349 3 trpS Tryptophan--tRNA ligase Rhizobium meliloti (strain 1021)
Q8RXE9 2.7e-91 281 44 3 341 1 OVA4 Tryptophan--tRNA ligase, chloroplastic/mitochondrial Arabidopsis thaliana
Q1RIE3 1.41e-89 274 44 3 330 3 trpS Tryptophan--tRNA ligase Rickettsia bellii (strain RML369-C)
Q98C31 2.27e-89 275 40 1 351 3 trpS Tryptophan--tRNA ligase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8EVV1 9.75e-89 272 44 4 330 3 trpS Tryptophan--tRNA ligase Malacoplasma penetrans (strain HF-2)
Q9UGM6 1.02e-88 273 42 3 334 1 WARS2 Tryptophan--tRNA ligase, mitochondrial Homo sapiens
Q68WR2 1.24e-88 272 42 2 330 3 trpS Tryptophan--tRNA ligase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZD76 6.39e-87 268 41 2 330 3 trpS Tryptophan--tRNA ligase Rickettsia prowazekii (strain Madrid E)
Q8UIE8 1.61e-85 265 42 1 351 3 trpS Tryptophan--tRNA ligase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9CYK1 1.75e-83 259 40 3 327 1 Wars2 Tryptophan--tRNA ligase, mitochondrial Mus musculus
O42875 2.01e-83 259 41 5 346 3 msw1 Tryptophan--tRNA ligase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q3T099 5.81e-83 258 40 3 327 2 WARS2 Tryptophan--tRNA ligase, mitochondrial Bos taurus
Q9PQW8 1.12e-77 244 43 3 303 3 trpS Tryptophan--tRNA ligase Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q7NAT8 4.94e-74 235 39 5 350 3 trpS Tryptophan--tRNA ligase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q7MT94 8.28e-74 234 40 6 332 3 trpS Tryptophan--tRNA ligase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q86A90 5.68e-72 231 36 6 369 3 wars2 Tryptophan--tRNA ligase, mitochondrial Dictyostelium discoideum
P04803 1.15e-71 230 39 8 345 1 MSW1 Tryptophan--tRNA ligase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P75510 1.68e-70 226 38 6 340 1 trpS Tryptophan--tRNA ligase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q9RWV7 1.36e-64 210 38 8 336 3 trpS Tryptophan--tRNA ligase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8RGA3 2.09e-64 209 38 8 338 3 trpS Tryptophan--tRNA ligase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
C0HKD6 6.48e-64 209 35 7 334 2 wars-2 Tryptophan--tRNA ligase, mitochondrial Caenorhabditis elegans
Q5HW79 2.22e-62 204 38 7 327 3 trpS Tryptophan--tRNA ligase Campylobacter jejuni (strain RM1221)
Q9PIB4 2.22e-62 204 38 7 327 1 trpS Tryptophan--tRNA ligase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P47372 9.01e-61 201 35 4 342 3 trpS Tryptophan--tRNA ligase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9JYQ9 1.17e-53 182 33 7 340 3 trpS Tryptophan--tRNA ligase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q7UQA4 2.33e-53 181 36 7 329 3 trpS Tryptophan--tRNA ligase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q9JTQ0 4.85e-53 181 32 7 340 3 trpS Tryptophan--tRNA ligase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q7W5T6 9e-51 177 35 9 339 3 trpS Tryptophan--tRNA ligase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGI7 9e-51 177 35 9 339 3 trpS Tryptophan--tRNA ligase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VZ05 1.73e-50 177 35 9 339 3 trpS Tryptophan--tRNA ligase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8P3Z4 2.55e-49 173 34 10 336 3 trpS Tryptophan--tRNA ligase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q87B10 3.46e-49 173 35 10 338 3 trpS Tryptophan--tRNA ligase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
O83640 5.83e-48 167 30 8 341 3 trpS Tryptophan--tRNA ligase Treponema pallidum (strain Nichols)
Q8PFH5 1.05e-47 169 34 11 341 3 trpS Tryptophan--tRNA ligase Xanthomonas axonopodis pv. citri (strain 306)
Q9PG74 1.34e-47 169 35 10 338 3 trpS Tryptophan--tRNA ligase Xylella fastidiosa (strain 9a5c)
Q9WYW2 1.45e-47 166 34 11 338 1 trpS Tryptophan--tRNA ligase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q88NA1 4.31e-47 168 35 10 330 3 trpS Tryptophan--tRNA ligase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q87WW4 7.42e-47 167 34 10 330 3 trpS Tryptophan--tRNA ligase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9HVX6 1.28e-46 167 32 8 340 3 trpS Tryptophan--tRNA ligase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9PJF5 2.11e-46 164 32 10 340 3 trpS Tryptophan--tRNA ligase Chlamydia muridarum (strain MoPn / Nigg)
O84589 6.02e-46 162 31 10 344 1 trpS Tryptophan--tRNA ligase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q9CJD1 5.4e-44 157 34 11 344 3 trpS Tryptophan--tRNA ligase Lactococcus lactis subsp. lactis (strain IL1403)
Q9Z7A4 1.98e-42 153 29 10 344 3 trpS Tryptophan--tRNA ligase Chlamydia pneumoniae
Q46127 2.03e-41 150 33 9 341 3 trpS Tryptophan--tRNA ligase Clostridium longisporum
Q8DWP7 2.03e-40 147 32 11 344 3 trpS Tryptophan--tRNA ligase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2J5 2.03e-40 147 32 11 344 3 trpS Tryptophan--tRNA ligase Streptococcus agalactiae serotype III (strain NEM316)
Q8Y0A1 6.15e-39 145 40 2 167 3 trpS Tryptophan--tRNA ligase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P67596 6.59e-39 144 31 11 344 3 trpS Tryptophan--tRNA ligase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P67595 6.59e-39 144 31 11 344 3 trpS Tryptophan--tRNA ligase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P0DG61 2.38e-38 142 32 11 346 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M3 (strain SSI-1)
P67598 2.38e-38 142 32 11 346 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9A2 2.38e-38 142 32 11 346 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DG60 2.38e-38 142 32 11 346 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q99XH4 2.38e-38 142 32 11 346 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M1
Q821H9 3.71e-38 142 29 10 341 3 trpS Tryptophan--tRNA ligase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
O51038 7.1e-38 141 28 10 343 3 trpS Tryptophan--tRNA ligase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8DRR1 3.8e-37 139 31 11 344 3 trpS Tryptophan--tRNA ligase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9RVD6 9.93e-31 122 30 11 341 1 trpS2 Tryptophan--tRNA ligase 2 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
O67115 2.23e-18 88 40 1 87 3 trpS Tryptophan--tRNA ligase Aquifex aeolicus (strain VF5)
O67115 4.82e-14 75 41 3 111 3 trpS Tryptophan--tRNA ligase Aquifex aeolicus (strain VF5)
O26352 1.24e-10 65 29 10 248 3 trpS Tryptophan--tRNA ligase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q978Y8 1.95e-09 62 29 10 207 3 trpS Tryptophan--tRNA ligase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q97ZX0 2.17e-09 62 24 12 304 3 trpS Tryptophan--tRNA ligase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q58810 7.02e-09 60 30 9 240 3 trpS Tryptophan--tRNA ligase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8TXZ2 7.15e-08 57 23 8 230 3 tyrS Tyrosine--tRNA ligase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q976M1 4.68e-07 54 21 12 326 3 trpS Tryptophan--tRNA ligase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q8TYF7 6.65e-07 54 26 16 319 3 trpS Tryptophan--tRNA ligase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q9HIW5 1.64e-06 53 30 8 176 3 trpS Tryptophan--tRNA ligase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q9Y924 5.35e-06 51 25 10 243 1 trpS Tryptophan--tRNA ligase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q12W06 7.46e-06 50 22 1 166 3 tyrS Tyrosine--tRNA ligase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
A2BLD4 9.09e-06 50 26 11 248 3 trpS Tryptophan--tRNA ligase Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
Q5V4J1 1.63e-05 49 24 15 322 3 tyrS Tyrosine--tRNA ligase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
O27795 2.18e-05 49 23 10 232 3 tyrS Tyrosine--tRNA ligase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8PWV5 2.56e-05 49 27 11 251 3 trpS Tryptophan--tRNA ligase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q9HN83 7.18e-05 48 27 4 165 3 trpS1 Tryptophan--tRNA ligase 1 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
O29482 8.49e-05 47 21 5 223 1 tyrS Tyrosine--tRNA ligase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
C6A032 9.82e-05 47 23 9 226 3 trpS Tryptophan--tRNA ligase Thermococcus sibiricus (strain DSM 12597 / MM 739)
Q57834 0.000123 47 24 13 309 1 tyrS Tyrosine--tRNA ligase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O67632 0.000143 47 29 5 150 3 tyrS Tyrosine--tRNA ligase Aquifex aeolicus (strain VF5)
B6YUH1 0.000235 46 23 9 226 3 trpS Tryptophan--tRNA ligase Thermococcus onnurineus (strain NA1)
O59584 0.000279 46 20 7 230 1 trpS Tryptophan--tRNA ligase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q46BQ5 0.000285 45 21 7 240 3 tyrS Tyrosine--tRNA ligase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q8PVK0 0.000611 44 22 3 162 3 tyrS Tyrosine--tRNA ligase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q9HN66 0.001 44 24 9 225 3 trpS2 Tryptophan--tRNA ligase 2 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15000
Feature type CDS
Gene trpS
Product tryptophan--tRNA ligase
Location 3328399 - 3329427 (strand: 1)
Length 1029 (nucleotides) / 342 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1600
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00579 tRNA synthetases class I (W and Y)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0180 Translation, ribosomal structure and biogenesis (J) J Tryptophanyl-tRNA synthetase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01867 tryptophanyl-tRNA synthetase [EC:6.1.1.2] Aminoacyl-tRNA biosynthesis -

Protein Sequence

MTTSVEKKAQKPIVFSGAQPSGELTIGNYMGALRQWVQMQDDYDCIYCIVDQHAITVRQDPTELRKRTLDTLALYLACGIDPEKSTIFVQSHVPQHAQLGWALNCYTYFGELSRMTQFKDKSARHAENINAGLFDYPVLMAADILLYQTNQVPVGIDQKQHLELSRDIAQRFNAIYGDIFTVPDPFIPKGGARVMALQDPAKKMSKSDDNRNNVIALLEDPKAAAKKIKRAVTDSEEPPRVAYDLENKAGVSNLLDILAGVTGKTIPELEAEFEGKMYGHLKGAVAEAVSDMLTNIQERFNTFRNDEALLNKIMKEGADKAKARAQTTLDKVYEAIGFIAHP

Flanking regions ( +/- flanking 50bp)

GCTCTCTATCCTTGATATTACGTCAATGACAACAGTGGAACAGAACTAACATGACGACTTCAGTAGAAAAAAAGGCTCAAAAGCCTATTGTATTCAGTGGTGCACAACCTTCTGGTGAGTTAACTATCGGGAACTATATGGGAGCACTACGTCAGTGGGTACAAATGCAAGATGACTACGATTGCATTTACTGTATCGTTGACCAACATGCCATCACTGTACGCCAAGATCCTACCGAACTGCGAAAAAGAACCTTAGATACACTGGCTCTTTATCTCGCTTGTGGCATTGATCCTGAAAAAAGCACAATTTTTGTACAATCTCATGTTCCACAACATGCACAATTAGGCTGGGCGCTAAACTGCTACACCTACTTTGGTGAATTAAGCCGTATGACCCAATTTAAAGATAAATCAGCTCGTCATGCTGAAAATATCAATGCAGGATTATTTGATTATCCGGTCTTAATGGCAGCCGATATCCTCCTTTATCAAACCAACCAAGTACCCGTTGGTATTGACCAAAAACAACATCTTGAATTAAGCCGTGATATCGCCCAACGCTTTAATGCCATCTATGGGGACATTTTCACCGTACCCGATCCTTTTATTCCAAAAGGTGGCGCACGCGTGATGGCATTACAAGATCCCGCTAAGAAAATGTCTAAATCTGATGATAACCGCAATAATGTTATCGCTTTACTTGAAGATCCCAAAGCGGCGGCGAAAAAAATAAAACGTGCTGTTACAGACTCAGAAGAGCCACCTCGCGTTGCGTATGATCTAGAAAACAAAGCTGGTGTTTCTAACTTATTAGATATTTTAGCGGGTGTAACAGGTAAAACTATCCCTGAACTCGAAGCTGAATTTGAAGGCAAAATGTACGGTCATCTAAAAGGCGCGGTTGCTGAGGCTGTATCAGATATGCTGACAAATATTCAAGAACGCTTTAACACCTTCCGTAATGATGAAGCACTATTAAATAAAATCATGAAAGAAGGTGCCGATAAGGCAAAAGCGCGCGCTCAAACAACCTTAGATAAGGTTTATGAGGCTATTGGGTTTATTGCTCACCCATAATCGTTATTACAGGCCAGTTGACATCCTCCACGCCCTAAAGGACGTGGAGC