Homologs in group_2789

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08935 FBDBKF_08935 44.2 Morganella morganii S1 nikB nickel ABC transporter permease subunit NikB
EHELCC_10475 EHELCC_10475 44.2 Morganella morganii S2 nikB nickel ABC transporter permease subunit NikB
NLDBIP_10820 NLDBIP_10820 44.2 Morganella morganii S4 nikB nickel ABC transporter permease subunit NikB
LHKJJB_10535 LHKJJB_10535 44.2 Morganella morganii S3 nikB nickel ABC transporter permease subunit NikB
HKOGLL_13595 HKOGLL_13595 44.2 Morganella morganii S5 nikB nickel ABC transporter permease subunit NikB

Distribution of the homologs in the orthogroup group_2789

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2789

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P33591 1.31e-90 275 45 0 308 1 nikB Nickel transport system permease protein NikB Escherichia coli (strain K12)
A0A0H3K104 3.54e-70 223 37 3 310 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FVE8 4.85e-70 223 37 3 310 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain NCTC 8325 / PS 47)
P42062 2.36e-59 195 34 4 322 3 appB Oligopeptide transport system permease protein AppB Bacillus subtilis (strain 168)
Q32IB7 8.02e-57 188 31 2 311 3 gsiC Glutathione transport system permease protein GsiC Shigella dysenteriae serotype 1 (strain Sd197)
Q1RE94 8.02e-57 188 31 2 311 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli (strain UTI89 / UPEC)
P75798 8.02e-57 188 31 2 311 1 gsiC Glutathione transport system permease protein GsiC Escherichia coli (strain K12)
Q0TJL7 8.02e-57 188 31 2 311 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A970 8.02e-57 188 31 2 311 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O1:K1 / APEC
Q3Z3V2 1.08e-56 188 31 1 307 3 gsiC Glutathione transport system permease protein GsiC Shigella sonnei (strain Ss046)
Q8X6V7 2.11e-56 187 31 2 311 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O157:H7
Q0T6D1 2.3e-56 187 31 2 311 3 gsiC Glutathione transport system permease protein GsiC Shigella flexneri serotype 5b (strain 8401)
Q83S26 5.49e-56 186 31 2 311 3 gsiC Glutathione transport system permease protein GsiC Shigella flexneri
Q8FJK9 7.58e-56 186 31 2 311 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q323W3 1.1e-55 185 31 2 311 3 gsiC Glutathione transport system permease protein GsiC Shigella boydii serotype 4 (strain Sb227)
Q8Z862 1.15e-55 185 32 4 315 3 gsiC Glutathione transport system permease protein GsiC Salmonella typhi
Q57RB0 1.15e-55 185 32 4 315 3 gsiC Glutathione transport system permease protein GsiC Salmonella choleraesuis (strain SC-B67)
Q8ZQM2 1.91e-55 185 32 4 315 3 gsiC Glutathione transport system permease protein GsiC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PGP5 1.93e-55 185 32 4 315 3 gsiC Glutathione transport system permease protein GsiC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q2YJK1 1.57e-54 182 35 3 308 3 BAB2_1050 Putative peptide transport system permease protein BAB2_1050 Brucella abortus (strain 2308)
Q8VQK4 1.57e-54 182 35 3 308 3 BruAb2_1031 Putative peptide transport system permease protein BruAb2_1031 Brucella abortus biovar 1 (strain 9-941)
Q8YDG7 2e-54 182 35 3 308 3 BMEII0209 Putative peptide transport system permease protein BMEII0209 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FUX0 1.74e-53 180 35 3 308 3 BRA1092 Putative peptide transport system permease protein BRA1092/BS1330_II1084 Brucella suis biovar 1 (strain 1330)
Q6D3B1 1.79e-53 180 34 4 311 3 gsiC Glutathione transport system permease protein GsiC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8FWN8 1.24e-50 172 31 3 318 3 BRA0408 Putative peptide permease protein BRA0408/BS1330_II0405 Brucella suis biovar 1 (strain 1330)
A0A0H2ZGW7 1.52e-50 173 33 4 336 1 dppB Di/tripeptide transport system permease protein DppB Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8YBN9 7.86e-50 171 31 3 318 3 BMEII0860 Putative peptide permease protein BMEII0860 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A5VU90 7.86e-50 171 31 3 318 3 BOV_A0351 Putative peptide permease protein BOV_A0351 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P45096 1.08e-48 168 31 4 336 3 dppB Dipeptide transport system permease protein DppB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q53191 1.97e-47 164 30 3 312 3 NGR_a01430 Probable peptide ABC transporter permease protein y4tP Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q6GH25 2.07e-47 164 29 2 307 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MRSA252)
Q2YXY7 3.92e-47 164 29 2 307 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q5HG38 2.02e-46 162 28 2 307 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain COL)
Q2FYQ5 2.02e-46 162 28 2 307 1 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH55 2.02e-46 162 28 2 307 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain USA300)
Q8NWT4 2.27e-46 162 28 2 307 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MW2)
Q6G9H8 2.27e-46 162 28 2 307 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MSSA476)
Q7A5Q6 2.81e-46 162 28 2 307 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain N315)
Q99UA0 2.81e-46 162 28 2 307 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0AEF8 2.59e-45 159 28 2 339 1 dppB Dipeptide transport system permease protein DppB Escherichia coli (strain K12)
P0AEF9 2.59e-45 159 28 2 339 3 dppB Dipeptide transport system permease protein DppB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG0 2.59e-45 159 28 2 339 3 dppB Dipeptide transport system permease protein DppB Escherichia coli O157:H7
P94311 8.37e-45 158 29 2 335 3 dppB Dipeptide transport system permease protein DppB Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
P08005 2.07e-43 154 30 4 312 1 oppB Oligopeptide transport system permease protein OppB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A2RI75 7.39e-43 152 30 1 262 1 dppB Dipeptide transport system permease protein DppB Lactococcus lactis subsp. cremoris (strain MG1363)
P0A4N8 2.18e-42 151 31 4 321 3 oppB Oligopeptide transport system permease protein OppB Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N7 2.18e-42 151 31 4 321 1 oppB Oligopeptide transport system permease protein OppB Lactococcus lactis subsp. lactis (strain IL1403)
P0AFH5 1.11e-41 149 28 3 310 3 oppB Oligopeptide transport system permease protein OppB Shigella flexneri
P0AFH2 1.11e-41 149 28 3 310 1 oppB Oligopeptide transport system permease protein OppB Escherichia coli (strain K12)
P0AFH3 1.11e-41 149 28 3 310 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFH4 1.11e-41 149 28 3 310 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O157:H7
P26903 1.21e-41 149 30 3 309 2 dppB Dipeptide transport system permease protein DppB Bacillus subtilis (strain 168)
P45054 7.26e-40 144 27 3 310 3 oppB Oligopeptide transport system permease protein OppB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P77308 6.42e-39 143 30 4 339 1 ddpB Probable D,D-dipeptide transport system permease protein DdpB Escherichia coli (strain K12)
A9CKL3 4.92e-34 130 26 6 357 3 yejB Peptidoglycan transport system permease protein YejB Agrobacterium fabrum (strain C58 / ATCC 33970)
P0AGH3 3.47e-30 119 28 1 271 1 sapB Putrescine export system permease protein SapB Escherichia coli (strain K12)
P0AGH4 3.47e-30 119 28 1 271 3 sapB Peptide transport system permease protein SapB Escherichia coli O157:H7
P66967 1.75e-29 117 28 6 328 3 BQ2027_MB1314C Putative peptide transport permease protein Mb1314c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ7 1.75e-29 117 28 6 328 1 Rv1283c Putative peptide transport permease protein Rv1283c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ6 1.75e-29 117 28 6 328 3 MT1320 Putative peptide transport permease protein MT1320 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P24138 4.36e-28 113 25 3 316 1 oppB Oligopeptide transport system permease protein OppB Bacillus subtilis (strain 168)
P0AFU0 5.41e-25 106 24 5 359 1 yejB Inner membrane ABC transporter permease protein YejB Escherichia coli (strain K12)
P0AFU1 5.41e-25 106 24 5 359 3 yejB Inner membrane ABC transporter permease protein YejB Escherichia coli O157:H7
P0A2J3 3.42e-23 100 26 1 271 2 sapB Peptide transport system permease protein SapB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J4 3.42e-23 100 26 1 271 3 sapB Peptide transport system permease protein SapB Salmonella typhi
P47323 6.01e-17 84 24 8 320 3 oppB Oligopeptide transport system permease protein OppB Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P45286 4.4e-14 75 22 3 280 3 sapB Peptide transport system permease protein SapB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A4M8 9.5e-14 74 29 2 146 3 amiC Oligopeptide transport system permease protein AmiC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M7 9.5e-14 74 29 2 146 3 amiC Oligopeptide transport system permease protein AmiC Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P75554 7.27e-13 72 21 2 268 3 oppB Oligopeptide transport system permease protein OppB Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14565
Feature type CDS
Gene -
Product ABC transporter permease subunit
Location 3228962 - 3229888 (strand: -1)
Length 927 (nucleotides) / 308 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2789
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component
PF19300 Binding-prot-dependent transport system membrane comp, N-term

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0601 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)		 EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15585 nickel transport system permease protein ABC transporters -

Protein Sequence

MLRYLCWRLLAILPLVLIISFIAFVLLNLAPSDPAEVALRVNEIVPTPEAIEGMRRELGLDKPFFTRYFLWLVAGFQLDFGTSFLTRKPVIQEMLTALPPTLWLAATALLFTLIIALPLALWCVAKPHSLIDKSIRLIVFVLTAIPNYWLGLLLIWAVAVHLDWLPVSGMLTPQSVILPAFALSLGYIGTYLRLLRGAMLNQWHQPYVFYARTRGLPDKLILRRHILRNSLASALTALGMSIPKLIAGTVVIENIFAWPGVGRLCISAIFGRDYPMIQAYILMMSLLFLFFNFLIDIIQMKVDPRLRR

Flanking regions ( +/- flanking 50bp)

AGAGGTTACTTCAATATGGCACTGATCCGGTGCCATATTGGTTAAAGCAGATGTTACGTTATCTATGTTGGCGCCTATTGGCGATATTGCCGCTAGTATTGATTATTTCGTTTATTGCCTTTGTTTTGCTGAATTTAGCACCGTCTGATCCGGCAGAAGTGGCTTTGCGTGTTAACGAAATTGTACCGACGCCCGAAGCGATTGAAGGTATGCGCCGTGAGCTTGGTTTAGATAAGCCTTTTTTCACACGCTACTTTTTATGGCTTGTAGCGGGATTTCAACTGGATTTTGGCACCTCTTTTTTGACCCGAAAACCGGTGATACAAGAGATGTTAACTGCTCTCCCCCCCACGCTTTGGTTAGCGGCTACCGCATTATTATTTACGCTTATTATCGCGTTACCTTTAGCCTTATGGTGTGTGGCAAAACCACATAGCTTGATAGACAAAAGTATTCGGCTGATTGTTTTTGTGTTAACCGCAATTCCTAATTATTGGTTAGGGTTGTTGTTAATTTGGGCGGTGGCGGTTCATTTAGATTGGTTACCTGTCAGTGGTATGTTGACACCACAATCGGTCATTTTACCGGCATTTGCACTCTCTTTAGGTTATATCGGCACTTATTTACGTTTGTTACGGGGCGCAATGCTTAATCAATGGCATCAGCCTTATGTATTTTATGCCCGAACAAGAGGATTACCTGATAAGCTGATTTTGCGTCGCCATATATTACGTAATTCACTCGCTTCTGCGCTGACGGCGCTAGGAATGAGTATTCCGAAACTTATCGCGGGCACGGTCGTGATCGAGAATATTTTTGCATGGCCTGGGGTGGGGCGACTGTGTATTAGTGCCATATTTGGACGCGATTATCCGATGATACAAGCTTATATTTTAATGATGTCATTGTTATTTCTCTTTTTTAACTTTCTGATAGATATCATTCAGATGAAAGTCGATCCTCGTCTAAGGCGGTAACAATGTGGCGGTTATTCTGGCAACGACTTGCGCAAGATAAAAGTGCACAA