Homologs in group_1640

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10815 FBDBKF_10815 73.3 Morganella morganii S1 hisM ABC-type amino acid transport system, permease component
EHELCC_19405 EHELCC_19405 73.3 Morganella morganii S2 hisM ABC-type amino acid transport system, permease component
NLDBIP_14980 NLDBIP_14980 73.3 Morganella morganii S4 hisM ABC-type amino acid transport system, permease component
LHKJJB_14365 LHKJJB_14365 73.3 Morganella morganii S3 hisM ABC-type amino acid transport system, permease component
HKOGLL_12985 HKOGLL_12985 73.3 Morganella morganii S5 hisM ABC-type amino acid transport system, permease component
F4V73_RS14500 F4V73_RS14500 72.3 Morganella psychrotolerans - amino acid ABC transporter permease

Distribution of the homologs in the orthogroup group_1640

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1640

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O34606 5.76e-31 117 34 3 210 2 glnP Probable glutamine ABC transporter permease protein GlnP Bacillus subtilis (strain 168)
P0AEQ9 4.38e-29 112 34 6 212 3 glnP Glutamine transport system permease protein GlnP Shigella flexneri
P0AEQ6 4.38e-29 112 34 6 212 1 glnP Glutamine transport system permease protein GlnP Escherichia coli (strain K12)
P0AEQ7 4.38e-29 112 34 6 212 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEQ8 4.38e-29 112 34 6 212 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O157:H7
P0AER5 3.7e-28 110 32 6 213 1 gltK Glutamate/aspartate import permease protein GltK Escherichia coli (strain K12)
P0AER6 3.7e-28 110 32 6 213 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AER7 3.7e-28 110 32 6 213 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O157:H7
P0AFT4 9.06e-28 108 33 6 210 3 tcyL L-cystine transport system permease protein TcyL Shigella flexneri
P0AFT2 9.06e-28 108 33 6 210 1 tcyL L-cystine transport system permease protein TcyL Escherichia coli (strain K12)
P0AFT3 9.06e-28 108 33 6 210 3 tcyL L-cystine transport system permease protein TcyL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42200 6.46e-26 104 30 4 201 1 tcyB L-cystine transport system permease protein TcyB Bacillus subtilis (strain 168)
O34671 4.05e-25 101 32 6 225 2 glnM Probable glutamine ABC transporter permease protein GlnM Bacillus subtilis (strain 168)
P54536 1.05e-24 100 30 4 211 1 artQ Arginine transport system permease protein ArtQ Bacillus subtilis (strain 168)
P42399 1.01e-23 98 33 5 191 3 yckA Probable amino-acid ABC transporter permease protein YckA Bacillus subtilis (strain 168)
P45768 9.39e-23 98 32 2 167 1 yhdY Inner membrane amino-acid ABC transporter permease protein YhdY Escherichia coli (strain K12)
P45023 1.6e-22 94 31 4 196 3 HI_1079 Probable amino-acid ABC transporter permease protein HI_0179 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q52814 2.95e-21 94 27 2 211 3 aapM General L-amino acid transport system permease protein AapM Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P52625 8.89e-21 90 33 3 174 3 patM Probable amino-acid ABC transporter permease protein PatM Vibrio harveyi
P55660 1.72e-20 90 32 3 166 3 NGR_a01530 Probable amino-acid ABC transporter permease protein y4tF Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O34931 3.53e-20 89 34 2 161 1 tcyM L-cystine transport system permease protein TcyM Bacillus subtilis (strain 168)
P54953 1.23e-19 87 31 3 169 1 yxeN Probable amino-acid permease protein YxeN Bacillus subtilis (strain 168)
P48245 7.3e-19 86 28 4 219 1 gluD Glutamate transport system permease protein GluD Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8RQL4 3.35e-18 84 29 5 221 3 gluD Glutamate transport system permease protein GluD Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P0AE36 6.18e-18 83 26 7 241 3 artQ Arginine ABC transporter permease protein ArtQ Shigella flexneri
P0AE34 6.18e-18 83 26 7 241 1 artQ Arginine ABC transporter permease protein ArtQ Escherichia coli (strain K12)
P0AE35 6.18e-18 83 26 7 241 3 artQ Arginine ABC transporter permease protein ArtQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q68XN8 9.97e-18 82 29 4 202 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UKC4 1.18e-17 82 28 3 200 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92J96 1.37e-17 82 29 4 202 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q52665 3.84e-17 83 29 3 212 3 bztC Glutamate/glutamine/aspartate/asparagine transport system permease protein BztC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P41083 4.29e-17 80 28 4 202 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia prowazekii (strain Madrid E)
P45090 1.18e-16 79 32 2 132 3 artQ Arginine ABC transporter permease protein ArtQ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q1RHC0 2.15e-16 78 30 5 203 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia bellii (strain RML369-C)
P35114 4.67e-16 78 29 6 205 2 occM Octopine transport system permease protein OccM Rhizobium radiobacter
P72296 1.47e-14 74 29 6 200 3 occM Octopine transport system permease protein OccM Rhizobium meliloti
P45767 3.17e-14 74 32 2 126 3 yhdX Putative amino-acid ABC transporter permease protein YhdX Escherichia coli (strain K12)
Q52664 5.19e-14 74 33 0 125 3 bztB Glutamate/glutamine/aspartate/asparagine transport system permease protein BztB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O34315 5.52e-14 72 27 2 155 1 tcyL L-cystine transport system permease protein TcyL Bacillus subtilis (strain 168)
P55661 1.97e-13 70 29 5 187 3 NGR_a01520 Probable amino-acid ABC transporter permease protein y4tG Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0AER3 6.1e-13 69 25 4 195 1 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli (strain K12)
P0AER4 6.1e-13 69 25 4 195 3 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P48244 1.39e-12 68 30 4 200 1 gluC Glutamate transport system permease protein GluC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P72295 2.39e-12 67 26 5 213 3 occQ Octopine transport system permease protein OccQ Rhizobium meliloti
Q8RQL5 3.28e-12 67 29 4 195 3 gluC Glutamate transport system permease protein GluC Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q52813 1.3e-11 67 35 0 97 3 aapQ General L-amino acid transport system permease protein AapQ Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P35113 5.1e-11 64 33 1 111 3 nocM Nopaline transport system permease protein NocM Agrobacterium fabrum (strain C58 / ATCC 33970)
P35118 1.3e-10 63 28 7 213 3 nocQ Nopaline transport system permease protein NocQ Agrobacterium fabrum (strain C58 / ATCC 33970)
P52094 1.47e-10 62 23 4 198 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Escherichia coli (strain K12)
P0A2I9 2.8e-10 62 23 2 195 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J0 2.8e-10 62 23 2 195 3 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhi
P0A2I7 1.71e-09 59 25 9 232 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2I8 1.71e-09 59 25 9 232 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhi
P0A4N5 2.54e-09 59 28 4 171 2 occQ Octopine transport system permease protein OccQ Rhizobium radiobacter
P0A4N6 2.54e-09 59 28 4 171 3 occQ Octopine transport system permease protein OccQ Agrobacterium tumefaciens (strain Ach5)
P0AE33 3.23e-09 58 27 5 196 3 artM Arginine ABC transporter permease protein ArtM Shigella flexneri
P0AE30 3.23e-09 58 27 5 196 1 artM Arginine ABC transporter permease protein ArtM Escherichia coli (strain K12)
P0AE31 3.23e-09 58 27 5 196 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE32 3.23e-09 58 27 5 196 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O157:H7
Q8NQU3 3.84e-09 59 30 8 180 1 argU Arginine transport system permease protein ArgU Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P0AEU6 1.41e-08 57 26 4 166 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Shigella flexneri
P0AEU3 1.41e-08 57 26 4 166 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli (strain K12)
P0AEU4 1.41e-08 57 26 4 166 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEU5 1.41e-08 57 26 4 166 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O157:H7
P45089 3.45e-06 50 37 2 79 3 artM Arginine ABC transporter permease protein ArtM Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14335
Feature type CDS
Gene -
Product amino acid ABC transporter permease
Location 3180679 - 3181428 (strand: 1)
Length 750 (nucleotides) / 249 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1640
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0765 Amino acid transport and metabolism (E) E ABC-type amino acid transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02029 polar amino acid transport system permease protein - -

Protein Sequence

MDFTVIADNWQYLLFGAYPDGPLEGAALTIFISVIAGIVSIILGTLGGIALAMLKGVWVNLFAAFLGFFRAIPVIMLIFWLYFLLPVVLGMEIPEITTVICALALITSSYIAHGVKAGILAIGKGQWQAGLSLGFNRWQTLWYIVLPQALRMMVPSFINQWIALIKDTSLAYVVGVGELSFLATQVNNRSMVYPMEVFLFVAFIYFVLCFSLELIANRVGKLFTTQKEKRSFWQYVIPNKKPSLSEKII

Flanking regions ( +/- flanking 50bp)

AGCTTGGGGGCAATGGCATCAGCAACGAAAATTAGCGCAAGGATATTAATATGGACTTTACTGTTATTGCTGATAATTGGCAGTATCTACTTTTTGGCGCGTATCCTGATGGGCCATTAGAAGGTGCGGCTTTAACTATATTTATTAGTGTGATCGCCGGTATTGTATCTATTATATTAGGGACGCTTGGGGGGATCGCTCTCGCCATGCTTAAAGGGGTATGGGTTAACTTATTTGCCGCTTTTTTAGGTTTTTTCCGTGCTATTCCGGTCATTATGTTGATTTTTTGGCTCTATTTTCTATTACCCGTGGTATTAGGAATGGAAATTCCTGAGATAACCACCGTGATCTGTGCTCTAGCACTTATTACCTCCTCTTATATCGCTCATGGTGTTAAAGCCGGTATTCTCGCTATTGGCAAAGGGCAATGGCAAGCAGGTTTATCGTTAGGATTTAATCGCTGGCAGACGCTTTGGTATATCGTGTTACCACAAGCATTACGTATGATGGTGCCCTCTTTTATCAATCAATGGATAGCCTTAATTAAAGATACTTCCCTCGCTTATGTTGTAGGTGTCGGTGAACTCTCATTCTTAGCAACACAAGTTAATAATCGCAGCATGGTGTACCCGATGGAAGTTTTTTTATTTGTTGCCTTTATTTACTTTGTGCTCTGTTTTTCATTAGAGTTAATTGCCAACCGAGTGGGGAAATTATTTACCACCCAAAAAGAAAAACGCTCTTTTTGGCAATATGTTATCCCTAATAAAAAACCTTCACTGAGTGAAAAAATTATTTAACTTATTCATCCCCTAATAATATTGATTAGGGGATTAAATAATAACCATCA