Homologs in group_1768

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12070 FBDBKF_12070 80.0 Morganella morganii S1 pbuX Xanthine/uracil permease
EHELCC_14235 EHELCC_14235 80.0 Morganella morganii S2 pbuX Xanthine/uracil permease
NLDBIP_15330 NLDBIP_15330 80.0 Morganella morganii S4 pbuX Xanthine/uracil permease
LHKJJB_15280 LHKJJB_15280 80.0 Morganella morganii S3 pbuX Xanthine/uracil permease
HKOGLL_14400 HKOGLL_14400 80.0 Morganella morganii S5 pbuX Xanthine/uracil permease
F4V73_RS14575 F4V73_RS14575 79.5 Morganella psychrotolerans - uracil-xanthine permease family protein

Distribution of the homologs in the orthogroup group_1768

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1768

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AGN2 0.0 733 82 1 455 3 xanP Xanthine permease XanP Shigella flexneri
P0AGM9 0.0 733 82 1 455 1 xanP Xanthine permease XanP Escherichia coli (strain K12)
P0AGN0 0.0 733 82 1 455 3 xanP Xanthine permease XanP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGN1 0.0 733 82 1 455 3 xanP Xanthine permease XanP Escherichia coli O157:H7
P67444 1.56e-121 365 46 1 443 1 xanQ Xanthine permease XanQ Escherichia coli (strain K12)
P67445 1.56e-121 365 46 1 443 3 xanQ Xanthine permease XanQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67446 1.56e-121 365 46 1 443 3 xanQ Xanthine permease XanQ Escherichia coli O157:H7
P50487 3.44e-74 243 33 5 454 3 cpx Putative purine permease CPE0397 Clostridium perfringens (strain 13 / Type A)
Q9HE12 4.67e-61 212 32 13 501 3 SPAC1399.01c Putative purine permease C1399.01c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0A2A5JY22 4.05e-58 200 32 6 420 1 PL1_3014 Nucleobase transporter PlUacP Paenibacillus larvae subsp. larvae (strain NRRL B-3650 / LMG 16245)
Q07307 1.38e-57 202 33 9 481 1 uapA Uric acid-xanthine permease Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P42086 3.17e-57 198 30 6 427 3 pbuX Xanthine permease Bacillus subtilis (strain 168)
P48777 7.42e-54 192 32 11 469 2 uapC Purine permease Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
O32140 1.06e-51 183 30 7 439 2 pucK Uric acid permease PucK Bacillus subtilis (strain 168)
O32139 2.08e-47 172 32 7 422 2 pucJ Uric acid permease PucJ Bacillus subtilis (strain 168)
Q46821 1.37e-46 171 30 7 422 1 uacT Uric acid transporter UacT Escherichia coli (strain K12)
P0AGM7 1.59e-23 105 26 12 398 1 uraA Uracil permease Escherichia coli (strain K12)
P0AGM8 1.59e-23 105 26 12 398 1 uraA Uracil permease Escherichia coli O157:H7
A0A2A5K1W4 1.29e-21 100 25 10 400 1 PL1_0655 Uracil permease Paenibacillus larvae subsp. larvae (strain NRRL B-3650 / LMG 16245)
B0JZG0 5.56e-18 90 24 17 517 2 slc23a2 Solute carrier family 23 member 2 Xenopus tropicalis
Q9UGH3 1.6e-17 89 23 16 513 1 SLC23A2 Solute carrier family 23 member 2 Homo sapiens
Q9EPR4 1.49e-16 85 23 16 511 1 Slc23a2 Solute carrier family 23 member 2 Mus musculus
Q9UHI7 1.62e-16 85 23 19 535 1 SLC23A1 Solute carrier family 23 member 1 Homo sapiens
Q9WTW8 2e-16 85 23 16 511 1 Slc23a2 Solute carrier family 23 member 2 Rattus norvegicus
Q27GI3 3.83e-15 81 24 16 446 2 NAT6 Nucleobase-ascorbate transporter 6 Arabidopsis thaliana
Q9WTW7 7.9e-15 80 23 19 528 2 Slc23a1 Solute carrier family 23 member 1 Rattus norvegicus
P41006 9.64e-15 79 24 15 446 3 pyrP Uracil permease Bacillus caldolyticus
Q9SHZ3 2.63e-14 78 24 14 435 2 NAT1 Nucleobase-ascorbate transporter 1 Arabidopsis thaliana
Q9Z2J0 2.65e-14 79 24 20 517 1 Slc23a1 Solute carrier family 23 member 1 Mus musculus
Q8RWE9 4.73e-13 74 23 19 480 2 NAT5 Nucleobase-ascorbate transporter 5 Arabidopsis thaliana
Q94C70 2.86e-12 72 22 16 466 2 NAT2 Nucleobase-ascorbate transporter 2 Arabidopsis thaliana
P75892 9.82e-12 70 23 12 422 1 rutG Putative pyrimidine permease RutG Escherichia coli (strain K12)
P39766 7.06e-11 67 26 8 276 1 pyrP Uracil permease Bacillus subtilis (strain 168)
Q8VZQ5 9.81e-11 67 24 21 510 2 NAT8 Nucleobase-ascorbate transporter 8 Arabidopsis thaliana
Q41760 2.13e-10 66 22 12 449 1 LPE1 Nucleobase-ascorbate transporter LPE1 Zea mays
Q0WPE9 6.92e-10 64 23 15 435 2 NAT7 Nucleobase-ascorbate transporter 7 Arabidopsis thaliana
Q3E7D0 1.12e-09 64 23 12 455 1 NAT12 Nucleobase-ascorbate transporter 12 Arabidopsis thaliana
Q8GZD4 1.3e-09 63 21 13 479 2 NAT3 Nucleobase-ascorbate transporter 3 Arabidopsis thaliana
P93039 1.38e-09 63 23 12 428 2 NAT4 Nucleobase-ascorbate transporter 4 Arabidopsis thaliana
Q9CPL9 3.49e-08 59 23 7 252 3 uraA Probable uracil permease Pasteurella multocida (strain Pm70)
P45117 4.14e-06 52 22 7 252 3 uraA Probable uracil permease Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P39618 3.77e-05 49 22 15 423 2 ywdJ Putative purine permease YwdJ Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14175
Feature type CDS
Gene -
Product uracil-xanthine permease family protein
Location 3147454 - 3148845 (strand: 1)
Length 1392 (nucleotides) / 463 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1768
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00860 Permease family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2233 Nucleotide transport and metabolism (F) F Xanthine/uracil permease

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K16345 xanthine permease XanP - -

Protein Sequence

MVTSENRNLSQSSQISPQKTSELLFALEEKPPLLQTLFAACQHLLAMFVAVITPAILICQALGLPAHDTQRIISMSLFASGIASLIQIRAWGPVGSGLLSIQGTSFNFVAPLIMGGLALKNGGADIPTMMAALFGTLMVASLTEVLLSRFLHLARRIITPLVSGIVVMIIGLSLIQVGLTSIGGGYAAIESNTFGSPKNLLLAGSVLVVIILLNRQRNPYLRVASLVIAMAVGYILAWWLDMLPTPPEQQETPIITVPEPFYYGLSFDWHLLIPLMLVFMITSLETIGDITATSDVSEQPVSGPLYMKRIKGGVLANGLNSMVSAFFNTFPNSCFGQNNGVIQLTGVASRYVGYVVAAMLIILGLFPSVAEFVQRIPEPVLGGATLVMFGTIAASGVRIVSKEALNRRAIMILAISLAVGLGVSQQPQILQFAPDWLKTLLSSGIAAGGLTAIILNLIFPPEK

Flanking regions ( +/- flanking 50bp)

GTGGCGCAGATCATTAAAATACGCTTTTTGCCAGATAAGAAATTCACATCATGGTTACTTCAGAAAATCGTAATTTGTCACAAAGTAGTCAGATTTCGCCCCAAAAAACGAGTGAACTTTTATTCGCTTTAGAAGAAAAGCCCCCATTACTACAAACACTATTTGCGGCTTGTCAGCATCTATTAGCCATGTTTGTCGCCGTAATAACCCCTGCTATCTTAATTTGCCAAGCATTAGGGTTACCTGCACATGACACTCAACGCATTATCAGCATGTCATTATTCGCCTCAGGTATTGCATCACTGATCCAAATTCGAGCTTGGGGTCCCGTAGGTTCAGGTTTATTATCAATTCAAGGCACCAGTTTTAATTTTGTGGCTCCTCTGATTATGGGGGGGTTGGCATTAAAAAATGGTGGCGCGGATATTCCAACAATGATGGCGGCTCTATTTGGCACTTTAATGGTTGCTTCACTTACCGAAGTGCTATTATCGCGTTTTTTACATTTAGCTCGCCGGATTATCACACCATTGGTATCAGGAATTGTGGTGATGATTATCGGCCTTTCTTTAATTCAAGTTGGGCTTACTTCTATTGGTGGTGGTTACGCCGCTATTGAAAGTAACACCTTTGGCTCACCTAAAAACCTTTTATTAGCGGGTTCGGTATTAGTGGTTATTATTTTACTTAACCGCCAAAGAAACCCTTATTTACGTGTCGCTTCTTTAGTGATTGCTATGGCTGTCGGTTATATTTTGGCATGGTGGCTAGATATGCTACCTACACCGCCTGAACAACAAGAAACACCGATTATCACCGTACCAGAACCTTTCTATTATGGCCTCTCATTTGATTGGCATTTACTTATCCCACTAATGCTGGTGTTTATGATCACCTCATTAGAAACCATTGGTGATATTACTGCCACCTCAGATGTTTCAGAACAACCCGTCAGTGGGCCACTTTATATGAAACGCATTAAAGGGGGCGTATTAGCAAATGGATTGAACTCTATGGTTTCTGCGTTTTTTAATACCTTTCCAAACTCCTGTTTTGGGCAAAATAACGGCGTTATTCAATTAACAGGTGTGGCAAGTCGCTATGTGGGCTATGTCGTAGCAGCCATGTTGATTATTTTAGGGTTATTTCCCTCTGTGGCAGAATTTGTACAACGAATTCCTGAACCTGTACTGGGAGGGGCAACGCTTGTTATGTTTGGTACTATCGCTGCATCTGGGGTGCGTATCGTCTCTAAAGAGGCGCTAAATCGTCGTGCTATTATGATCCTCGCCATCTCTTTGGCCGTAGGACTTGGGGTATCACAGCAACCTCAAATATTACAGTTTGCACCAGATTGGCTAAAAACATTACTGTCATCCGGTATTGCTGCAGGCGGTCTAACCGCTATTATTTTAAACCTGATTTTTCCACCCGAAAAATAATCATTAATAAACTTCCAAATAATAAAGCGCTATTTTCATAATCAAAAATA