Homologs in group_203

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11985 FBDBKF_11985 86.7 Morganella morganii S1 dppB dipeptide ABC transporter permease DppB
FBDBKF_20665 FBDBKF_20665 87.9 Morganella morganii S1 dppB Dipeptide transporter permease DppB
EHELCC_14320 EHELCC_14320 86.7 Morganella morganii S2 dppB dipeptide ABC transporter permease DppB
NLDBIP_15415 NLDBIP_15415 86.7 Morganella morganii S4 dppB dipeptide ABC transporter permease DppB
LHKJJB_15195 LHKJJB_15195 86.7 Morganella morganii S3 dppB dipeptide ABC transporter permease DppB
HKOGLL_14315 HKOGLL_14315 86.7 Morganella morganii S5 dppB dipeptide ABC transporter permease DppB
F4V73_RS14670 F4V73_RS14670 85.8 Morganella psychrotolerans dppB dipeptide ABC transporter permease DppB

Distribution of the homologs in the orthogroup group_203

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_203

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEF8 0.0 597 85 0 339 1 dppB Dipeptide transport system permease protein DppB Escherichia coli (strain K12)
P0AEF9 0.0 597 85 0 339 3 dppB Dipeptide transport system permease protein DppB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG0 0.0 597 85 0 339 3 dppB Dipeptide transport system permease protein DppB Escherichia coli O157:H7
A0A0H2ZGW7 7.74e-163 461 67 1 339 1 dppB Di/tripeptide transport system permease protein DppB Pseudomonas aeruginosa (strain UCBPP-PA14)
P45096 2.25e-140 404 59 2 337 3 dppB Dipeptide transport system permease protein DppB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P94311 1.89e-99 300 46 2 337 3 dppB Dipeptide transport system permease protein DppB Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q8FJK9 8.81e-87 266 41 3 342 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q32IB7 2.72e-86 265 41 3 342 3 gsiC Glutathione transport system permease protein GsiC Shigella dysenteriae serotype 1 (strain Sd197)
Q1RE94 2.72e-86 265 41 3 342 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli (strain UTI89 / UPEC)
P75798 2.72e-86 265 41 3 342 1 gsiC Glutathione transport system permease protein GsiC Escherichia coli (strain K12)
Q0TJL7 2.72e-86 265 41 3 342 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A970 2.72e-86 265 41 3 342 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O1:K1 / APEC
Q0T6D1 3.98e-86 265 41 3 342 3 gsiC Glutathione transport system permease protein GsiC Shigella flexneri serotype 5b (strain 8401)
Q8X6V7 5.4e-86 264 41 3 342 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O157:H7
Q83S26 7.4e-86 264 41 3 342 3 gsiC Glutathione transport system permease protein GsiC Shigella flexneri
Q3Z3V2 1.82e-85 263 41 2 338 3 gsiC Glutathione transport system permease protein GsiC Shigella sonnei (strain Ss046)
Q323W3 3.53e-85 262 41 3 342 3 gsiC Glutathione transport system permease protein GsiC Shigella boydii serotype 4 (strain Sb227)
Q8Z862 3.49e-84 259 42 3 342 3 gsiC Glutathione transport system permease protein GsiC Salmonella typhi
Q57RB0 3.49e-84 259 42 3 342 3 gsiC Glutathione transport system permease protein GsiC Salmonella choleraesuis (strain SC-B67)
Q8ZQM2 5.32e-84 259 42 3 342 3 gsiC Glutathione transport system permease protein GsiC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PGP5 6.91e-84 259 42 3 342 3 gsiC Glutathione transport system permease protein GsiC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q6D3B1 7.38e-81 251 40 2 338 3 gsiC Glutathione transport system permease protein GsiC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P42062 1.32e-76 241 37 4 338 3 appB Oligopeptide transport system permease protein AppB Bacillus subtilis (strain 168)
P77308 5.26e-75 237 43 2 329 1 ddpB Probable D,D-dipeptide transport system permease protein DdpB Escherichia coli (strain K12)
Q2YJK1 8.37e-69 220 39 4 338 3 BAB2_1050 Putative peptide transport system permease protein BAB2_1050 Brucella abortus (strain 2308)
Q8VQK4 8.37e-69 220 39 4 338 3 BruAb2_1031 Putative peptide transport system permease protein BruAb2_1031 Brucella abortus biovar 1 (strain 9-941)
Q8YDG7 9.29e-69 220 39 4 338 3 BMEII0209 Putative peptide transport system permease protein BMEII0209 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FUX0 9.48e-68 218 39 4 338 3 BRA1092 Putative peptide transport system permease protein BRA1092/BS1330_II1084 Brucella suis biovar 1 (strain 1330)
P26903 1.41e-67 217 36 5 341 2 dppB Dipeptide transport system permease protein DppB Bacillus subtilis (strain 168)
Q53191 2.44e-66 214 36 3 334 3 NGR_a01430 Probable peptide ABC transporter permease protein y4tP Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8FWN8 7.93e-66 213 37 4 338 3 BRA0408 Putative peptide permease protein BRA0408/BS1330_II0405 Brucella suis biovar 1 (strain 1330)
P0AGH3 1.8e-65 212 38 4 282 1 sapB Putrescine export system permease protein SapB Escherichia coli (strain K12)
P0AGH4 1.8e-65 212 38 4 282 3 sapB Peptide transport system permease protein SapB Escherichia coli O157:H7
Q8YBN9 5.51e-65 211 37 4 338 3 BMEII0860 Putative peptide permease protein BMEII0860 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A5VU90 5.51e-65 211 37 4 338 3 BOV_A0351 Putative peptide permease protein BOV_A0351 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P24138 1.41e-59 197 37 4 340 1 oppB Oligopeptide transport system permease protein OppB Bacillus subtilis (strain 168)
P33591 1.92e-59 196 33 2 341 1 nikB Nickel transport system permease protein NikB Escherichia coli (strain K12)
P0A2J3 4.17e-59 196 38 4 283 2 sapB Peptide transport system permease protein SapB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J4 4.17e-59 196 38 4 283 3 sapB Peptide transport system permease protein SapB Salmonella typhi
P08005 1.5e-57 191 34 4 338 1 oppB Oligopeptide transport system permease protein OppB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AFH5 2.8e-57 191 34 4 338 3 oppB Oligopeptide transport system permease protein OppB Shigella flexneri
P0AFH2 2.8e-57 191 34 4 338 1 oppB Oligopeptide transport system permease protein OppB Escherichia coli (strain K12)
P0AFH3 2.8e-57 191 34 4 338 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFH4 2.8e-57 191 34 4 338 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O157:H7
P45054 3.09e-56 188 33 4 338 3 oppB Oligopeptide transport system permease protein OppB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A2RI75 3.66e-50 172 32 4 314 1 dppB Dipeptide transport system permease protein DppB Lactococcus lactis subsp. cremoris (strain MG1363)
Q2FVE8 2.13e-49 170 30 4 340 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H3K104 4.2e-49 169 30 4 340 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain Mu50 / ATCC 700699)
A9CKL3 1.06e-43 157 29 6 377 3 yejB Peptidoglycan transport system permease protein YejB Agrobacterium fabrum (strain C58 / ATCC 33970)
P0A4N8 4.45e-43 154 30 2 336 3 oppB Oligopeptide transport system permease protein OppB Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N7 4.45e-43 154 30 2 336 1 oppB Oligopeptide transport system permease protein OppB Lactococcus lactis subsp. lactis (strain IL1403)
Q2YXY7 7.77e-40 145 28 5 339 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain bovine RF122 / ET3-1)
P66967 3.29e-39 144 31 5 282 3 BQ2027_MB1314C Putative peptide transport permease protein Mb1314c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ7 3.29e-39 144 31 5 282 1 Rv1283c Putative peptide transport permease protein Rv1283c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ6 3.29e-39 144 31 5 282 3 MT1320 Putative peptide transport permease protein MT1320 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7A5Q6 4.08e-39 144 28 5 339 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain N315)
Q99UA0 4.08e-39 144 28 5 339 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG38 4.17e-39 144 28 5 339 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain COL)
Q2FYQ5 4.17e-39 144 28 5 339 1 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH55 4.17e-39 144 28 5 339 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain USA300)
Q8NWT4 4.83e-39 144 28 5 339 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MW2)
Q6G9H8 4.83e-39 144 28 5 339 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MSSA476)
Q6GH25 5.25e-39 144 28 5 339 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MRSA252)
P0AFU0 1.09e-34 133 28 6 378 1 yejB Inner membrane ABC transporter permease protein YejB Escherichia coli (strain K12)
P0AFU1 1.09e-34 133 28 6 378 3 yejB Inner membrane ABC transporter permease protein YejB Escherichia coli O157:H7
P45286 1.06e-29 119 27 3 273 3 sapB Peptide transport system permease protein SapB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A4M8 1.01e-20 96 28 4 234 3 amiC Oligopeptide transport system permease protein AmiC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M7 1.01e-20 96 28 4 234 3 amiC Oligopeptide transport system permease protein AmiC Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P47323 4.7e-20 93 24 7 341 3 oppB Oligopeptide transport system permease protein OppB Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75554 3.32e-19 90 25 5 282 3 oppB Oligopeptide transport system permease protein OppB Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
A0A0H2ZFV0 0.000232 45 26 3 141 1 dppC Di/tripeptide transport system permease protein DppC Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8FUW9 0.000246 45 28 3 128 3 BRA1093 Putative peptide transport system permease protein BRA1093/BS1330_II1085 Brucella suis biovar 1 (strain 1330)
Q8YDG8 0.000328 45 28 3 130 3 BMEII0207/BMEII0208 Putative peptide transport system permease protein BMEII0207/BMEII0208 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YJK0 0.000328 45 28 3 130 3 BAB2_1051 Putative peptide transport system permease protein BAB2_1051 Brucella abortus (strain 2308)
Q8VQK5 0.000328 45 28 3 130 3 BruAb2_1032 Putative peptide transport system permease protein BruAb2_1032 Brucella abortus biovar 1 (strain 9-941)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14060
Feature type CDS
Gene dppB
Product dipeptide ABC transporter permease DppB
Location 3121335 - 3122354 (strand: -1)
Length 1020 (nucleotides) / 339 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_203
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component
PF19300 Binding-prot-dependent transport system membrane comp, N-term

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0601 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)
EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12369 dipeptide transport system permease protein ABC transporters -

Protein Sequence

MLQFILQRLGLVIPTFIGITLLTFIFVHLIPGDPVMIMAGERGLSPERHAYLMAELGLDKPLWQQYLNYLNGIMHGDLGISLKSRIPVWDEFLPRFKATLELGICAMIFAVSVGIPVGVLAAVKRGSIFDHTAISVSLAGYSMPIFWWGIMLIMLVSVKLDLTPVSGRLADSVFLDDSYPLTGFMLIDTLFWGEEGDFLDALHHIILPAIVLGTIPLAVIVRMTRSAMLEVLGEDYIRTARAKGLSRARVILIHALRNAMLPVVTVIGLQVGTMLAGAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLIATMIIFVNLLVDVLYGIVNPRIRHKK

Flanking regions ( +/- flanking 50bp)

TGATTTATCAGCGCTATCTTTTAGCTGATGTGTAAAAAGAGAATTAGGATATGCTGCAATTTATCCTTCAGCGTTTGGGGCTCGTGATCCCAACGTTTATCGGAATTACGTTATTAACCTTTATTTTTGTCCATCTTATTCCGGGTGATCCGGTCATGATTATGGCGGGAGAGCGTGGATTATCACCAGAGCGTCACGCTTATTTAATGGCGGAATTAGGACTAGATAAACCGCTATGGCAACAATATTTAAATTACCTTAACGGCATTATGCACGGTGATTTAGGTATTTCACTAAAAAGTCGTATTCCTGTCTGGGATGAATTTTTGCCACGATTTAAAGCAACCTTAGAGCTAGGTATTTGTGCCATGATTTTTGCTGTTTCAGTGGGCATTCCCGTTGGGGTGCTTGCGGCAGTAAAACGAGGTTCTATTTTTGATCATACGGCAATCAGTGTGTCACTTGCAGGATATTCTATGCCTATCTTCTGGTGGGGGATCATGCTGATTATGCTCGTTTCAGTGAAGCTTGATCTAACACCTGTATCAGGCCGATTGGCGGATAGTGTCTTTCTAGATGATAGCTATCCACTAACGGGATTTATGTTGATTGATACGCTCTTTTGGGGGGAAGAAGGTGATTTTCTTGATGCGCTACACCATATTATTTTACCGGCCATTGTGCTTGGGACTATTCCATTAGCGGTTATTGTGCGCATGACGCGTTCGGCAATGTTGGAAGTATTGGGAGAAGATTATATTCGCACTGCCAGAGCAAAAGGATTAAGTCGTGCACGAGTGATTTTGATCCATGCATTACGTAACGCAATGTTACCTGTTGTGACGGTGATTGGTTTACAAGTTGGTACGATGCTAGCCGGAGCGATACTGACAGAAACTATTTTTTCATGGCCGGGTTTAGGTCGCTGGTTAATTGATGCTCTACAACGTCGAGACTACCCTGTTGTTCAAGGGGGAGTATTGCTCATTGCCACTATGATCATTTTCGTGAATCTATTAGTGGATGTGCTATATGGCATTGTTAACCCACGTATCCGTCATAAGAAATAAGGAGTGCATCATGGCTGAAAATAACGTAACACCGGTCATTAGTGCACCGG