Homologs in group_203

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11985 FBDBKF_11985 98.5 Morganella morganii S1 dppB dipeptide ABC transporter permease DppB
EHELCC_14320 EHELCC_14320 98.5 Morganella morganii S2 dppB dipeptide ABC transporter permease DppB
NLDBIP_15415 NLDBIP_15415 98.5 Morganella morganii S4 dppB dipeptide ABC transporter permease DppB
LHKJJB_15195 LHKJJB_15195 98.5 Morganella morganii S3 dppB dipeptide ABC transporter permease DppB
HKOGLL_14315 HKOGLL_14315 98.5 Morganella morganii S5 dppB dipeptide ABC transporter permease DppB
F4V73_RS14670 F4V73_RS14670 97.0 Morganella psychrotolerans dppB dipeptide ABC transporter permease DppB
PMI_RS14060 PMI_RS14060 87.9 Proteus mirabilis HI4320 dppB dipeptide ABC transporter permease DppB

Distribution of the homologs in the orthogroup group_203

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_203

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEF8 5.06e-34 120 89 0 66 1 dppB Dipeptide transport system permease protein DppB Escherichia coli (strain K12)
P0AEF9 5.06e-34 120 89 0 66 3 dppB Dipeptide transport system permease protein DppB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG0 5.06e-34 120 89 0 66 3 dppB Dipeptide transport system permease protein DppB Escherichia coli O157:H7
A0A0H2ZGW7 4.69e-29 107 72 0 66 1 dppB Di/tripeptide transport system permease protein DppB Pseudomonas aeruginosa (strain UCBPP-PA14)
P45096 1.01e-28 107 76 0 64 3 dppB Dipeptide transport system permease protein DppB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P94311 1.37e-22 90 59 0 64 3 dppB Dipeptide transport system permease protein DppB Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q6D3B1 1.13e-19 82 52 0 65 3 gsiC Glutathione transport system permease protein GsiC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q323W3 1.82e-19 82 50 0 65 3 gsiC Glutathione transport system permease protein GsiC Shigella boydii serotype 4 (strain Sb227)
Q83S26 1.88e-19 82 50 0 65 3 gsiC Glutathione transport system permease protein GsiC Shigella flexneri
Q3Z3V2 1.94e-19 82 50 0 65 3 gsiC Glutathione transport system permease protein GsiC Shigella sonnei (strain Ss046)
Q0T6D1 1.94e-19 82 50 0 65 3 gsiC Glutathione transport system permease protein GsiC Shigella flexneri serotype 5b (strain 8401)
Q8FJK9 2.08e-19 81 50 0 65 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q32IB7 2.1e-19 81 50 0 65 3 gsiC Glutathione transport system permease protein GsiC Shigella dysenteriae serotype 1 (strain Sd197)
Q1RE94 2.1e-19 81 50 0 65 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli (strain UTI89 / UPEC)
P75798 2.1e-19 81 50 0 65 1 gsiC Glutathione transport system permease protein GsiC Escherichia coli (strain K12)
Q0TJL7 2.1e-19 81 50 0 65 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A970 2.1e-19 81 50 0 65 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O1:K1 / APEC
Q8X6V7 2.24e-19 81 50 0 65 3 gsiC Glutathione transport system permease protein GsiC Escherichia coli O157:H7
Q8Z862 3.53e-19 81 52 0 65 3 gsiC Glutathione transport system permease protein GsiC Salmonella typhi
Q57RB0 3.53e-19 81 52 0 65 3 gsiC Glutathione transport system permease protein GsiC Salmonella choleraesuis (strain SC-B67)
Q8ZQM2 3.6e-19 81 52 0 65 3 gsiC Glutathione transport system permease protein GsiC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PGP5 3.8e-19 81 52 0 65 3 gsiC Glutathione transport system permease protein GsiC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q53191 3.54e-17 75 51 0 64 3 NGR_a01430 Probable peptide ABC transporter permease protein y4tP Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8FWN8 8.49e-16 72 50 0 60 3 BRA0408 Putative peptide permease protein BRA0408/BS1330_II0405 Brucella suis biovar 1 (strain 1330)
Q8YBN9 8.84e-16 72 50 0 60 3 BMEII0860 Putative peptide permease protein BMEII0860 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A5VU90 8.84e-16 72 50 0 60 3 BOV_A0351 Putative peptide permease protein BOV_A0351 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P42062 3.76e-14 67 39 0 64 3 appB Oligopeptide transport system permease protein AppB Bacillus subtilis (strain 168)
P0A2J3 7.73e-14 67 45 1 66 2 sapB Peptide transport system permease protein SapB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J4 7.73e-14 67 45 1 66 3 sapB Peptide transport system permease protein SapB Salmonella typhi
P33591 1.37e-13 66 40 0 66 1 nikB Nickel transport system permease protein NikB Escherichia coli (strain K12)
P0AGH3 1.73e-13 65 43 1 66 1 sapB Putrescine export system permease protein SapB Escherichia coli (strain K12)
P0AGH4 1.73e-13 65 43 1 66 3 sapB Peptide transport system permease protein SapB Escherichia coli O157:H7
Q8YDG7 1.88e-13 65 41 0 65 3 BMEII0209 Putative peptide transport system permease protein BMEII0209 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YJK1 1.96e-13 65 41 0 65 3 BAB2_1050 Putative peptide transport system permease protein BAB2_1050 Brucella abortus (strain 2308)
Q8VQK4 1.96e-13 65 41 0 65 3 BruAb2_1031 Putative peptide transport system permease protein BruAb2_1031 Brucella abortus biovar 1 (strain 9-941)
Q8FUX0 1.12e-12 63 40 0 65 3 BRA1092 Putative peptide transport system permease protein BRA1092/BS1330_II1084 Brucella suis biovar 1 (strain 1330)
Q2FVE8 6.57e-12 61 37 0 64 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H3K104 6.84e-12 61 37 0 64 1 cntB Metal-staphylopine import system permease protein CntB Staphylococcus aureus (strain Mu50 / ATCC 700699)
P24138 1.17e-11 60 37 0 66 1 oppB Oligopeptide transport system permease protein OppB Bacillus subtilis (strain 168)
P26903 1.55e-11 60 38 1 67 2 dppB Dipeptide transport system permease protein DppB Bacillus subtilis (strain 168)
Q6GH25 1.7e-11 60 39 0 63 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MRSA252)
Q2YXY7 1.73e-11 60 39 0 63 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A5Q6 1.93e-11 60 39 0 63 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain N315)
Q99UA0 1.93e-11 60 39 0 63 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG38 1.93e-11 60 39 0 63 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain COL)
Q2FYQ5 1.93e-11 60 39 0 63 1 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH55 1.93e-11 60 39 0 63 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain USA300)
Q8NWT4 1.97e-11 60 39 0 63 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MW2)
Q6G9H8 1.97e-11 60 39 0 63 3 nikB Nickel import system permease protein NikB Staphylococcus aureus (strain MSSA476)
A2RI75 3.87e-10 56 36 0 63 1 dppB Dipeptide transport system permease protein DppB Lactococcus lactis subsp. cremoris (strain MG1363)
P0AFH5 7.52e-10 55 39 0 64 3 oppB Oligopeptide transport system permease protein OppB Shigella flexneri
P0AFH2 7.52e-10 55 39 0 64 1 oppB Oligopeptide transport system permease protein OppB Escherichia coli (strain K12)
P0AFH3 7.52e-10 55 39 0 64 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFH4 7.52e-10 55 39 0 64 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O157:H7
P08005 7.98e-10 55 39 0 64 1 oppB Oligopeptide transport system permease protein OppB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45054 1.74e-08 52 34 0 64 3 oppB Oligopeptide transport system permease protein OppB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A4M8 4.08e-08 50 34 0 63 3 amiC Oligopeptide transport system permease protein AmiC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M7 4.08e-08 50 34 0 63 3 amiC Oligopeptide transport system permease protein AmiC Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P45286 1.38e-07 49 36 0 60 3 sapB Peptide transport system permease protein SapB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A9CKL3 4.34e-07 48 35 0 65 3 yejB Peptidoglycan transport system permease protein YejB Agrobacterium fabrum (strain C58 / ATCC 33970)
P77308 1.03e-06 47 46 0 62 1 ddpB Probable D,D-dipeptide transport system permease protein DdpB Escherichia coli (strain K12)
P0A4N8 1.94e-06 46 41 0 63 3 oppB Oligopeptide transport system permease protein OppB Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N7 1.94e-06 46 41 0 63 1 oppB Oligopeptide transport system permease protein OppB Lactococcus lactis subsp. lactis (strain IL1403)
P0AFU0 2.61e-06 45 33 0 65 1 yejB Inner membrane ABC transporter permease protein YejB Escherichia coli (strain K12)
P0AFU1 2.61e-06 45 33 0 65 3 yejB Inner membrane ABC transporter permease protein YejB Escherichia coli O157:H7
P66967 1.24e-05 43 26 0 63 3 BQ2027_MB1314C Putative peptide transport permease protein Mb1314c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ7 1.24e-05 43 26 0 63 1 Rv1283c Putative peptide transport permease protein Rv1283c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ6 1.24e-05 43 26 0 63 3 MT1320 Putative peptide transport permease protein MT1320 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P75554 7.37e-05 41 30 0 62 3 oppB Oligopeptide transport system permease protein OppB Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47323 0.000222 40 30 0 62 3 oppB Oligopeptide transport system permease protein OppB Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_20665
Feature type CDS
Gene dppB
Product Dipeptide transporter permease DppB
Location 58 - 258 (strand: 1)
Length 201 (nucleotides) / 66 (amino acids)
In genomic island -

Contig

Accession contig_98
Length 295 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_203
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0601 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)
EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Protein Sequence

MLAGAILTETIFSWPGIGRRLIDALQRRDYPVVQGGVLLIAILIILVNLCVDLLYGVVNPRIRHKK

Flanking regions ( +/- flanking 50bp)

TCAATGCGCTGCTGCCGGTGGTGACCGTTATCGGCTTACAGGTCGGCGTGATGCTGGCCGGGGCGATTCTGACCGAAACGATTTTTTCCTGGCCCGGTATCGGCCGCCGGCTGATTGATGCCCTTCAGCGCCGCGACTATCCGGTTGTGCAGGGCGGCGTTCTGCTGATCGCCATTCTGATTATCCTGGTTAACCTGTGCGTGGATTTACTCTACGGGGTCGTTAACCCGCGGATCCGTCATAAAAAATAACAGGAGCGCACAATGTCTGAGACGACAAGTACTACC