Homologs in group_1735

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11795 FBDBKF_11795 59.1 Morganella morganii S1 kefG glutathione-regulated potassium-efflux system ancillary protein KefG
EHELCC_14510 EHELCC_14510 59.1 Morganella morganii S2 kefG glutathione-regulated potassium-efflux system ancillary protein KefG
NLDBIP_15605 NLDBIP_15605 59.1 Morganella morganii S4 kefG glutathione-regulated potassium-efflux system ancillary protein KefG
LHKJJB_15005 LHKJJB_15005 59.1 Morganella morganii S3 kefG glutathione-regulated potassium-efflux system ancillary protein KefG
HKOGLL_19280 HKOGLL_19280 59.1 Morganella morganii S5 kefG glutathione-regulated potassium-efflux system ancillary protein KefG
F4V73_RS14860 F4V73_RS14860 57.8 Morganella psychrotolerans kefG glutathione-regulated potassium-efflux system ancillary protein KefG

Distribution of the homologs in the orthogroup group_1735

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1735

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A7ME22 5.02e-76 228 61 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Cronobacter sakazakii (strain ATCC BAA-894)
A1JS77 2.32e-75 227 60 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VK48 1.15e-74 225 58 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4WFE5 7.95e-74 223 58 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Enterobacter sp. (strain 638)
B7LS58 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I2R0 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain SE11)
B7NDW0 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A756 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain K12)
P0A757 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A5F9 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O9:H4 (strain HS)
B1X6K1 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain K12 / DH10B)
C4ZUK7 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1Q3 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O8 (strain IAI1)
B7NMB9 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTQ8 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A758 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O157:H7
B7L4M8 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain 55989 / EAEC)
A7ZSM7 2.04e-73 222 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O139:H28 (strain E24377A / ETEC)
Q6CZU4 2.18e-73 222 56 0 181 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1IPB3 2.25e-73 221 60 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
C6DG98 2.32e-73 221 57 0 181 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q1R5T1 2.62e-73 221 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain UTI89 / UPEC)
A1AGN7 2.62e-73 221 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O1:K1 / APEC
B7N1D3 2.62e-73 221 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O81 (strain ED1a)
B7MCW7 2.62e-73 221 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK62 2.62e-73 221 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q83PX9 2.86e-73 221 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Shigella flexneri
Q0SZW5 2.86e-73 221 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Shigella flexneri serotype 5b (strain 8401)
Q32B14 9.42e-73 220 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Shigella dysenteriae serotype 1 (strain Sd197)
Q0TCA9 1.21e-72 220 59 0 179 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7FNQ1 2.12e-72 219 60 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9R474 2.12e-72 219 60 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJC5 2.12e-72 219 60 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis
B1JIU3 2.24e-72 219 60 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664Q4 2.24e-72 219 60 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGX4 2.24e-72 219 60 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis (strain Pestoides F)
Q1CCS6 2.24e-72 219 60 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis bv. Antiqua (strain Nepal516)
B2K5P7 2.24e-72 219 60 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2S8 2.24e-72 219 60 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis bv. Antiqua (strain Antiqua)
A8GKL4 4.86e-72 218 58 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Serratia proteamaculans (strain 568)
A8AQP1 6.05e-72 218 57 0 178 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P65510 1.27e-69 212 56 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65511 1.27e-69 212 56 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella typhi
B4TXG0 1.27e-69 212 56 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella schwarzengrund (strain CVM19633)
B5BH04 1.27e-69 212 56 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella paratyphi A (strain AKU_12601)
Q5PL20 1.27e-69 212 56 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUV8 1.27e-69 212 56 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella newport (strain SL254)
B4TKN3 1.27e-69 212 56 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella heidelberg (strain SL476)
B5R2A9 1.27e-69 212 56 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella enteritidis PT4 (strain P125109)
B5FJN2 1.27e-69 212 56 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella dublin (strain CT_02021853)
Q57J14 1.27e-69 212 56 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella choleraesuis (strain SC-B67)
B5F8H0 1.27e-69 212 56 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella agona (strain SL483)
A9MT18 6.85e-69 210 55 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
C0Q0D4 6.92e-69 210 55 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella paratyphi C (strain RKS4594)
B5RGZ7 1.06e-68 210 55 0 180 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella gallinarum (strain 287/91 / NCTC 13346)
P54439 5.06e-41 139 39 0 169 3 yrkL Uncharacterized NAD(P)H oxidoreductase YrkL Bacillus subtilis (strain 168)
P80871 4.38e-40 137 38 0 173 1 ywrO General stress protein 14 Bacillus subtilis (strain 168)
P96674 7.31e-34 122 39 0 164 3 ydeQ Uncharacterized NAD(P)H oxidoreductase YdeQ Bacillus subtilis (strain 168)
Q8ZRW3 2.47e-33 119 38 2 183 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5R1S3 3.57e-33 119 38 2 183 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella enteritidis PT4 (strain P125109)
B5FI28 3.57e-33 119 38 2 183 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella dublin (strain CT_02021853)
C0Q4M9 3.81e-33 119 38 2 183 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella paratyphi C (strain RKS4594)
B4T6L1 3.81e-33 119 38 2 183 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella newport (strain SL254)
Q57TH5 3.81e-33 119 38 2 183 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella choleraesuis (strain SC-B67)
Q8Z9K1 1.35e-32 117 37 2 183 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella typhi
B5RGB7 1.6e-32 117 37 2 183 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella gallinarum (strain 287/91 / NCTC 13346)
B4TII5 1.68e-32 117 37 2 183 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella heidelberg (strain SL476)
B5F766 1.68e-32 117 37 2 183 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella agona (strain SL483)
B4TWT0 2.94e-32 117 37 2 172 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella schwarzengrund (strain CVM19633)
A9MQG7 2.97e-32 117 37 2 183 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4W6F2 8.09e-31 113 37 1 166 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Enterobacter sp. (strain 638)
Q83SQ4 1.27e-30 112 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Shigella flexneri
Q0T8E9 1.27e-30 112 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Shigella flexneri serotype 5b (strain 8401)
Q3Z5W3 1.4e-30 112 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Shigella sonnei (strain Ss046)
Q326I7 1.54e-30 112 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Shigella boydii serotype 4 (strain Sb227)
B2U254 1.54e-30 112 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1IRD0 1.54e-30 112 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8ALQ5 2.48e-30 112 34 2 183 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q0TLU3 3.11e-30 112 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1LFY0 3.78e-30 111 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain SMS-3-5 / SECEC)
B6HYZ7 3.78e-30 111 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain SE11)
B7N7S1 3.78e-30 111 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A754 3.78e-30 111 37 1 177 1 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain K12)
P0A755 3.78e-30 111 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZVZ8 3.78e-30 111 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O9:H4 (strain HS)
B1XC47 3.78e-30 111 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain K12 / DH10B)
C4ZPX2 3.78e-30 111 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0E3 3.78e-30 111 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O8 (strain IAI1)
B7MNQ3 3.78e-30 111 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O81 (strain ED1a)
B7NHF0 3.78e-30 111 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L4G9 3.78e-30 111 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain 55989 / EAEC)
B7UI92 3.78e-30 111 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHD9 3.78e-30 111 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1RGF2 6.77e-30 110 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain UTI89 / UPEC)
A1A795 6.77e-30 110 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O1:K1 / APEC
B7MAG9 6.77e-30 110 37 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O45:K1 (strain S88 / ExPEC)
B7LVT7 9.77e-30 110 37 1 166 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5YZ82 1.01e-29 110 36 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XA24 1.01e-29 110 36 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O157:H7
Q32K50 1.57e-29 110 36 1 177 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Shigella dysenteriae serotype 1 (strain Sd197)
Q9X755 1.02e-27 105 36 2 172 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Klebsiella aerogenes
B5Y1Z9 3.82e-27 103 36 2 172 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Klebsiella pneumoniae (strain 342)
Q5RBB9 7.71e-15 73 29 6 212 2 NQO2 Ribosyldihydronicotinamide dehydrogenase [quinone] Pongo abelii
P16083 3.22e-14 71 28 6 212 1 NQO2 Ribosyldihydronicotinamide dehydrogenase [quinone] Homo sapiens
Q9JI75 2.71e-13 68 26 8 220 1 Nqo2 Ribosyldihydronicotinamide dehydrogenase [quinone] Mus musculus
Q6AY80 6.26e-11 62 28 7 204 1 Nqo2 Ribosyldihydronicotinamide dehydrogenase [quinone] Rattus norvegicus
Q8CHK7 2.37e-09 58 34 3 110 2 NQO1 NAD(P)H dehydrogenase [quinone] 1 Cavia porcellus
A0A481WNM5 3.23e-09 58 29 8 179 3 traD Ribosyldihydronicotinamide dehydrogenase-like protein traD Penicillium crustosum
P05982 3.34e-09 58 29 4 139 1 Nqo1 NAD(P)H dehydrogenase [quinone] 1 Rattus norvegicus
Q5RD31 4.85e-09 57 28 4 139 2 NQO1 NAD(P)H dehydrogenase [quinone] 1 Pongo abelii
P15559 5.14e-09 57 28 4 139 1 NQO1 NAD(P)H dehydrogenase [quinone] 1 Homo sapiens
Q64669 7.44e-09 57 28 4 139 1 Nqo1 NAD(P)H dehydrogenase [quinone] 1 Mus musculus
P45245 0.000102 44 26 4 143 3 HI_1544 Uncharacterized NAD(P)H oxidoreductase HI_1544 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13860
Feature type CDS
Gene kefG
Product glutathione-regulated potassium-efflux system ancillary protein KefG
Location 3077968 - 3078528 (strand: -1)
Length 561 (nucleotides) / 186 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1735
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02525 Flavodoxin-like fold

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2249 General function prediction only (R) R Putative NADPH-quinone reductase (modulator of drug activity B)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11748 glutathione-regulated potassium-efflux system ancillary protein KefG - -

Protein Sequence

MSNASNVLLVYVHPEPRQSIANKALLRAVRDLENITIHDLYATYPDFFIDIHREQALLCQHQVIVFQFPLQTYSCPALLKEWQDRVLTRPFANKVGRAQLKGKTFRCVVTTGEPEHAYQHNGKNHYTLSELLRPIELMAEMCGMRWLSPMIIYSARQQSKTTLGHISDAYRQWLQAPLEGEHADGR

Flanking regions ( +/- flanking 50bp)

TGCATGGTAACGGAAAAAAAGGTTTCTGACACGTTTTGTAAGGAGGAATGATGTCAAACGCATCAAATGTTTTACTGGTGTATGTCCATCCCGAGCCGCGTCAATCTATCGCCAATAAAGCGTTGTTGCGTGCGGTGAGGGATCTGGAAAATATAACAATTCATGATTTATATGCCACTTACCCTGATTTTTTTATCGATATTCACCGTGAGCAAGCACTATTGTGTCAACATCAAGTCATTGTATTTCAGTTTCCATTACAAACTTATAGTTGTCCTGCGCTATTAAAAGAGTGGCAAGATAGAGTGCTCACGCGTCCTTTTGCTAATAAAGTTGGACGAGCTCAACTTAAAGGAAAAACATTCCGTTGTGTGGTGACTACTGGTGAGCCTGAACATGCTTATCAACATAATGGTAAAAATCACTACACACTATCTGAATTATTGCGTCCTATCGAGTTAATGGCGGAAATGTGTGGTATGCGCTGGTTATCGCCGATGATTATTTACTCCGCAAGGCAACAGTCCAAAACAACACTAGGGCATATTAGTGATGCTTATCGCCAATGGTTACAAGCACCGTTAGAGGGGGAACACGCGGATGGAAGGTAATTGGATGATAAAAGCCGTGCTGTTTTTCTTATGTGCTGCCGTGATTATGG