Homologs in group_1735

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11795 FBDBKF_11795 100.0 Morganella morganii S1 kefG glutathione-regulated potassium-efflux system ancillary protein KefG
EHELCC_14510 EHELCC_14510 100.0 Morganella morganii S2 kefG glutathione-regulated potassium-efflux system ancillary protein KefG
NLDBIP_15605 NLDBIP_15605 100.0 Morganella morganii S4 kefG glutathione-regulated potassium-efflux system ancillary protein KefG
HKOGLL_19280 HKOGLL_19280 100.0 Morganella morganii S5 kefG glutathione-regulated potassium-efflux system ancillary protein KefG
F4V73_RS14860 F4V73_RS14860 86.0 Morganella psychrotolerans kefG glutathione-regulated potassium-efflux system ancillary protein KefG
PMI_RS13860 PMI_RS13860 59.1 Proteus mirabilis HI4320 kefG glutathione-regulated potassium-efflux system ancillary protein KefG

Distribution of the homologs in the orthogroup group_1735

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1735

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8GKL4 2.1e-87 257 65 0 183 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Serratia proteamaculans (strain 568)
A4WFE5 1.67e-86 255 64 0 182 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Enterobacter sp. (strain 638)
A8AQP1 2.27e-86 254 62 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A1JS77 1.52e-85 253 63 0 182 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7LS58 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I2R0 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain SE11)
B7NDW0 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A756 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain K12)
P0A757 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A5F9 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O9:H4 (strain HS)
B1X6K1 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain K12 / DH10B)
C4ZUK7 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1Q3 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O8 (strain IAI1)
B7NMB9 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTQ8 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A758 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O157:H7
B7L4M8 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain 55989 / EAEC)
A7ZSM7 2.89e-83 247 61 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83PX9 5.33e-83 246 61 0 183 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Shigella flexneri
Q0SZW5 5.33e-83 246 61 0 183 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Shigella flexneri serotype 5b (strain 8401)
Q6CZU4 6.15e-83 246 63 0 177 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1IPB3 1.2e-82 245 61 0 183 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7FNQ1 1.96e-82 244 61 0 181 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VK48 2.5e-82 244 62 0 182 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DG98 2.75e-82 244 63 0 177 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q1R5T1 2.79e-82 244 61 1 183 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli (strain UTI89 / UPEC)
A1AGN7 2.79e-82 244 61 1 183 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O1:K1 / APEC
B7N1D3 2.79e-82 244 61 1 183 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O81 (strain ED1a)
B7MCW7 2.79e-82 244 61 1 183 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK62 2.79e-82 244 61 1 183 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q32B14 1.06e-81 243 60 1 184 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Shigella dysenteriae serotype 1 (strain Sd197)
A9R474 1.19e-81 243 61 0 181 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJC5 1.19e-81 243 61 0 181 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis
B1JIU3 1.54e-81 242 61 0 181 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664Q4 1.54e-81 242 61 0 181 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGX4 1.54e-81 242 61 0 181 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis (strain Pestoides F)
Q1CCS6 1.54e-81 242 61 0 181 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis bv. Antiqua (strain Nepal516)
B2K5P7 1.54e-81 242 61 0 181 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2S8 1.54e-81 242 61 0 181 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis bv. Antiqua (strain Antiqua)
Q0TCA9 6.31e-81 241 60 0 182 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P65510 6.59e-81 241 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65511 6.59e-81 241 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella typhi
B4TXG0 6.59e-81 241 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella schwarzengrund (strain CVM19633)
B5BH04 6.59e-81 241 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella paratyphi A (strain AKU_12601)
Q5PL20 6.59e-81 241 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUV8 6.59e-81 241 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella newport (strain SL254)
B4TKN3 6.59e-81 241 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella heidelberg (strain SL476)
B5R2A9 6.59e-81 241 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella enteritidis PT4 (strain P125109)
B5FJN2 6.59e-81 241 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella dublin (strain CT_02021853)
Q57J14 6.59e-81 241 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella choleraesuis (strain SC-B67)
B5F8H0 6.59e-81 241 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella agona (strain SL483)
A9MT18 7.85e-81 241 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A7ME22 8.86e-81 240 61 0 182 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Cronobacter sakazakii (strain ATCC BAA-894)
B5RGZ7 5.63e-80 238 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella gallinarum (strain 287/91 / NCTC 13346)
C0Q0D4 6.15e-80 238 61 0 176 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella paratyphi C (strain RKS4594)
P54439 3.38e-38 132 41 0 169 3 yrkL Uncharacterized NAD(P)H oxidoreductase YrkL Bacillus subtilis (strain 168)
P80871 1.29e-37 130 40 0 171 1 ywrO General stress protein 14 Bacillus subtilis (strain 168)
P96674 1.92e-36 128 43 0 164 3 ydeQ Uncharacterized NAD(P)H oxidoreductase YdeQ Bacillus subtilis (strain 168)
Q3Z5W3 3.03e-35 124 42 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Shigella sonnei (strain Ss046)
Q326I7 1.77e-34 122 41 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Shigella boydii serotype 4 (strain Sb227)
B2U254 1.77e-34 122 41 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1IRD0 1.77e-34 122 41 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8ZRW3 3.57e-34 122 41 2 178 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TWT0 4.15e-34 122 41 2 170 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella schwarzengrund (strain CVM19633)
Q83SQ4 5.94e-34 121 41 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Shigella flexneri
Q0T8E9 5.94e-34 121 41 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Shigella flexneri serotype 5b (strain 8401)
Q8Z9K1 6.54e-34 121 41 2 178 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella typhi
B5RGB7 6.54e-34 121 40 1 172 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella gallinarum (strain 287/91 / NCTC 13346)
C0Q4M9 9.05e-34 120 40 1 172 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella paratyphi C (strain RKS4594)
B4T6L1 9.05e-34 120 40 1 172 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella newport (strain SL254)
Q57TH5 9.05e-34 120 40 1 172 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella choleraesuis (strain SC-B67)
B4TII5 9.45e-34 120 41 2 178 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella heidelberg (strain SL476)
B5F766 9.45e-34 120 41 2 178 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella agona (strain SL483)
B5R1S3 9.87e-34 120 40 1 172 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella enteritidis PT4 (strain P125109)
B5FI28 9.87e-34 120 40 1 172 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella dublin (strain CT_02021853)
B7LVT7 1.73e-33 120 41 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LFY0 1.97e-33 120 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain SMS-3-5 / SECEC)
B6HYZ7 1.97e-33 120 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain SE11)
B7N7S1 1.97e-33 120 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A754 1.97e-33 120 40 1 164 1 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain K12)
P0A755 1.97e-33 120 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZVZ8 1.97e-33 120 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O9:H4 (strain HS)
B1XC47 1.97e-33 120 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain K12 / DH10B)
C4ZPX2 1.97e-33 120 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0E3 1.97e-33 120 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O8 (strain IAI1)
B7MNQ3 1.97e-33 120 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O81 (strain ED1a)
B7NHF0 1.97e-33 120 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L4G9 1.97e-33 120 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain 55989 / EAEC)
B7UI92 1.97e-33 120 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHD9 1.97e-33 120 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0TLU3 2.97e-33 119 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q32K50 3.04e-33 119 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Shigella dysenteriae serotype 1 (strain Sd197)
B5YZ82 3.85e-33 119 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XA24 3.85e-33 119 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O157:H7
Q1RGF2 1.6e-32 117 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli (strain UTI89 / UPEC)
A1A795 1.6e-32 117 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O1:K1 / APEC
B7MAG9 1.6e-32 117 40 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Escherichia coli O45:K1 (strain S88 / ExPEC)
A9MQG7 4.33e-32 116 39 1 172 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4W6F2 3.19e-31 114 39 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Enterobacter sp. (strain 638)
Q9X755 1.28e-30 113 38 2 176 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Klebsiella aerogenes
A8ALQ5 2.76e-30 112 38 1 164 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5Y1Z9 5.19e-30 111 38 2 176 3 kefF Glutathione-regulated potassium-efflux system ancillary protein KefF Klebsiella pneumoniae (strain 342)
P16083 1.49e-14 72 31 7 191 1 NQO2 Ribosyldihydronicotinamide dehydrogenase [quinone] Homo sapiens
Q5RBB9 4.41e-14 71 31 6 188 2 NQO2 Ribosyldihydronicotinamide dehydrogenase [quinone] Pongo abelii
Q9JI75 7.15e-14 70 30 7 206 1 Nqo2 Ribosyldihydronicotinamide dehydrogenase [quinone] Mus musculus
Q6AY80 5.41e-13 68 30 7 206 1 Nqo2 Ribosyldihydronicotinamide dehydrogenase [quinone] Rattus norvegicus
A0A481WNM5 1.12e-08 56 29 7 174 3 traD Ribosyldihydronicotinamide dehydrogenase-like protein traD Penicillium crustosum
P45245 1.3e-07 52 29 5 145 3 HI_1544 Uncharacterized NAD(P)H oxidoreductase HI_1544 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P05982 2.39e-07 52 33 5 116 1 Nqo1 NAD(P)H dehydrogenase [quinone] 1 Rattus norvegicus
Q64669 7.92e-06 48 31 5 116 1 Nqo1 NAD(P)H dehydrogenase [quinone] 1 Mus musculus
Q8CHK7 1.42e-05 47 30 3 110 2 NQO1 NAD(P)H dehydrogenase [quinone] 1 Cavia porcellus
Q5RD31 1.81e-05 47 30 4 115 2 NQO1 NAD(P)H dehydrogenase [quinone] 1 Pongo abelii
P15559 2.75e-05 47 30 4 115 1 NQO1 NAD(P)H dehydrogenase [quinone] 1 Homo sapiens

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_15005
Feature type CDS
Gene kefG
Product glutathione-regulated potassium-efflux system ancillary protein KefG
Location 9718 - 10284 (strand: -1)
Length 567 (nucleotides) / 188 (amino acids)
In genomic island -

Contig

Accession ZDB_373
Length 137108 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1735
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02525 Flavodoxin-like fold

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2249 General function prediction only (R) R Putative NADPH-quinone reductase (modulator of drug activity B)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11748 glutathione-regulated potassium-efflux system ancillary protein KefG - -

Protein Sequence

MINNPTILLIYAHPEPHHSIANKALISAASELGHVTVHDLYGTYPDFFIDIRHEQELLRQHDIIVFQHPLYTYSCPALLKEWFDRVLTRDFSGEQGGRQLSGKYWRQVITTGEPAEAYQHGGYNRFPISELLRPFELTAALCEMHWLAPVILYAARRQGKAMLHEQAQAYCDWLRAPQLTGGRKNGAS

Flanking regions ( +/- flanking 50bp)

GGGCATAGTAGCGAAAATCACAAAGATTCTCACGTTTTTAAGAGGAAGTGATGATAAATAATCCGACTATATTACTGATTTACGCCCATCCGGAACCGCATCACTCCATCGCCAACAAGGCGCTTATCTCTGCGGCGTCGGAACTCGGGCATGTGACGGTGCATGACCTGTACGGCACCTATCCGGACTTTTTTATCGATATCCGCCATGAGCAGGAACTGCTGCGGCAGCATGACATCATTGTGTTTCAGCACCCGCTGTACACTTACAGTTGCCCCGCGCTGCTGAAAGAGTGGTTTGACCGCGTGCTGACCCGTGATTTCTCCGGTGAACAGGGCGGCAGACAGCTGTCCGGCAAATACTGGCGCCAGGTGATCACAACAGGGGAACCGGCGGAAGCTTATCAGCACGGCGGCTATAACCGTTTTCCGATCAGTGAGTTACTGAGACCGTTTGAGCTGACGGCGGCACTGTGTGAAATGCACTGGCTGGCACCGGTTATTCTCTATGCCGCACGCCGCCAGGGAAAAGCCATGCTGCATGAGCAGGCGCAGGCGTATTGTGACTGGCTGCGGGCACCGCAACTGACCGGAGGGCGTAAAAATGGAGCCAGCTGACGGCAACCTGCTGCATGCAGGTATTGTGTTTCTCGCGGCAGCCGTGGTGA