Homologs in group_2424

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19555 FBDBKF_19555 59.2 Morganella morganii S1 zur zinc uptake transcriptional repressor Zur
EHELCC_16500 EHELCC_16500 59.2 Morganella morganii S2 zur zinc uptake transcriptional repressor Zur
NLDBIP_16710 NLDBIP_16710 59.2 Morganella morganii S4 zur zinc uptake transcriptional repressor Zur
LHKJJB_16760 LHKJJB_16760 59.2 Morganella morganii S3 zur zinc uptake transcriptional repressor Zur
HKOGLL_18855 HKOGLL_18855 59.2 Morganella morganii S5 zur zinc uptake transcriptional repressor Zur
F4V73_RS18570 F4V73_RS18570 59.9 Morganella psychrotolerans zur zinc uptake transcriptional repressor Zur

Distribution of the homologs in the orthogroup group_2424

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2424

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AC52 6.5e-74 222 67 0 158 3 zur Zinc uptake regulation protein Shigella flexneri
P0AC51 6.5e-74 222 67 0 158 1 zur Zinc uptake regulation protein Escherichia coli (strain K12)
P9WN85 6.21e-09 55 31 2 129 1 zur Zinc uptake regulation protein Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN84 6.21e-09 55 31 2 129 3 zur Zinc uptake regulation protein Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0C631 2.81e-08 53 28 3 145 1 fur Ferric uptake regulation protein Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FKI7 2.81e-08 53 28 3 145 3 fur Ferric uptake regulation protein Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
P71086 6.34e-08 52 24 1 137 1 perR Peroxide operon regulator Bacillus subtilis (strain 168)
Q8CNQ7 9.97e-08 52 23 1 131 3 perR Peroxide-responsive repressor PerR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HN74 9.97e-08 52 23 1 131 3 perR Peroxide-responsive repressor PerR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q49YQ6 1.04e-07 52 23 1 131 3 perR Peroxide-responsive repressor PerR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7A0J4 3.6e-07 50 25 3 132 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain MW2)
Q9RQL3 3.6e-07 50 25 3 132 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus
Q6G873 3.6e-07 50 25 3 132 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain MSSA476)
Q6GFJ6 3.6e-07 50 25 3 132 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain MRSA252)
Q5HER3 3.6e-07 50 25 3 132 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain COL)
Q2YU25 3.6e-07 50 25 3 132 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G282 3.6e-07 50 25 3 132 1 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFN4 3.6e-07 50 25 3 132 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain USA300)
P54574 4.87e-07 50 28 3 129 1 fur Ferric uptake regulation protein Bacillus subtilis (strain 168)
Q7A4T8 5.36e-07 50 25 3 132 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain N315)
Q99T18 5.36e-07 50 25 3 132 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q55244 1.07e-06 49 27 3 137 3 fur Ferric uptake regulation protein Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q4L7G4 7.03e-06 47 21 1 133 3 perR Peroxide-responsive repressor PerR Staphylococcus haemolyticus (strain JCSC1435)
P0A3E3 7.14e-06 47 27 3 131 3 fur Ferric uptake regulation protein Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A3E5 7.14e-06 47 27 3 131 3 fur Ferric uptake regulation protein Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A3E4 7.14e-06 47 27 3 131 3 fur Ferric uptake regulation protein Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q51008 1.06e-05 46 24 4 129 3 fur Ferric uptake regulation protein Neisseria gonorrhoeae
P0A0S8 2.25e-05 45 24 4 129 3 fur Ferric uptake regulation protein Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0S7 2.25e-05 45 24 4 129 3 fur Ferric uptake regulation protein Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0A0S9 2.27e-05 45 24 4 129 3 fur Ferric uptake regulation protein Neisseria meningitidis serogroup C
P33086 3.03e-05 45 28 6 157 3 fur Ferric uptake regulation protein Yersinia pestis
O69450 0.000574 42 27 2 112 3 fur1 Ferric uptake regulation protein 1 (Fragment) Mycolicibacterium fortuitum

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13545
Feature type CDS
Gene zur
Product zinc uptake transcriptional repressor Zur
Location 3005138 - 3005668 (strand: 1)
Length 531 (nucleotides) / 176 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2424
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01475 Ferric uptake regulator family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0735 Inorganic ion transport and metabolism (P) P Fe2+ or Zn2+ uptake regulation protein Fur/Zur

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09823 Fur family transcriptional regulator, zinc uptake regulator Quorum sensing -

Protein Sequence

MNEEKLLAQAEKICQKRGVRLTSQRLAVLRLIMQQPTAISAYDLLDLLRQVEPQAKPPTVYRGLEFLLEQGFIHKIESTNSYVLCHHFDDAEHTSVMLICDRCLSVTEKSSHKIEGAITTLAKDNGFHLRHSVIEIHGLCAQCHEAQACTHPEGCHHDHSMDDNLKQKKTGDYKPR

Flanking regions ( +/- flanking 50bp)

AAATATGGTAAGATCATCGCAATTAATCACGTCTGAGAGCATCCTATCCTATGAATGAAGAGAAATTGCTCGCTCAGGCAGAAAAGATCTGCCAGAAACGAGGTGTTCGCCTGACTTCACAACGTCTGGCAGTATTGCGTCTGATCATGCAACAACCTACCGCAATCAGCGCTTATGATTTATTAGATTTATTACGCCAAGTAGAGCCTCAAGCTAAACCACCTACCGTATATCGTGGATTGGAATTTCTACTTGAACAAGGTTTTATTCACAAAATAGAATCCACCAATAGCTATGTGCTTTGTCATCATTTTGATGATGCTGAGCATACATCGGTGATGTTAATTTGTGATCGTTGCTTATCAGTCACAGAAAAAAGTAGCCATAAAATTGAAGGGGCGATCACCACACTCGCTAAAGATAATGGCTTTCATTTACGCCATAGTGTGATTGAAATTCATGGGCTGTGCGCTCAGTGCCATGAAGCCCAAGCCTGTACACATCCGGAAGGTTGTCACCATGATCATAGTATGGATGATAATCTTAAGCAGAAAAAAACCGGTGACTATAAGCCTCGTTAAGCAGATAAAAGATAAAAGTCAGCGGAACATATGTTTTTTTGTATAAATTA