Homologs in group_366

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16490 FBDBKF_16490 29.9 Morganella morganii S1 acrA MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit
EHELCC_08355 EHELCC_08355 29.9 Morganella morganii S2 acrA MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit
NLDBIP_08680 NLDBIP_08680 29.9 Morganella morganii S4 acrA MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit
LHKJJB_05585 LHKJJB_05585 29.9 Morganella morganii S3 acrA MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit
HKOGLL_05330 HKOGLL_05330 29.9 Morganella morganii S5 acrA MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit
F4V73_RS03005 F4V73_RS03005 29.2 Morganella psychrotolerans - MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit
PMI_RS07730 PMI_RS07730 27.5 Proteus mirabilis HI4320 - MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit

Distribution of the homologs in the orthogroup group_366

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_366

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57500 2.42e-37 141 27 7 382 3 HI_0894 Uncharacterized protein HI_0894 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
D2BTK6 3.8e-25 108 26 11 352 3 mdtA Multidrug resistance protein MdtA Dickeya zeae (strain Ech586)
D4I6V2 4.07e-25 108 28 12 346 3 mdtA Multidrug resistance protein MdtA Erwinia amylovora (strain ATCC 49946 / CCPPB 0273 / Ea273 / 27-3)
A4WCC0 5.05e-24 105 29 13 349 3 mdtA Multidrug resistance protein MdtA Enterobacter sp. (strain 638)
D3V7P2 1.16e-23 104 27 10 339 3 mdtA Multidrug resistance protein MdtA Xenorhabdus bovienii (strain SS-2004)
C9XVZ5 7.09e-23 102 27 9 344 3 mdtA Multidrug resistance protein MdtA Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
F2EYD8 8.54e-23 102 27 9 335 3 mdtA Multidrug resistance protein MdtA Pantoea ananatis (strain AJ13355)
C6DBC6 8.46e-22 99 27 10 337 3 mdtA Multidrug resistance protein MdtA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B7ME86 3.16e-21 97 27 13 355 3 mdtA Multidrug resistance protein MdtA Escherichia coli O45:K1 (strain S88 / ExPEC)
Q6D2B2 4.94e-21 97 25 9 337 3 mdtA Multidrug resistance protein MdtA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2TYA9 9.26e-21 96 27 12 347 3 mdtA Multidrug resistance protein MdtA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5YUD2 9.26e-21 96 27 12 347 3 mdtA Multidrug resistance protein MdtA Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X7J5 9.26e-21 96 27 12 347 3 mdtA Multidrug resistance protein MdtA Escherichia coli O157:H7
A7ZNP7 1.3e-20 95 27 13 353 3 mdtA Multidrug resistance protein MdtA Escherichia coli O139:H28 (strain E24377A / ETEC)
A6TBH3 1.53e-20 95 26 10 357 3 mdtA Multidrug resistance protein MdtA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7NQB2 1.54e-20 95 26 13 359 3 mdtA Multidrug resistance protein MdtA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7NCB0 2.21e-20 95 26 13 357 3 mdtA Multidrug resistance protein MdtA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1LNW7 2.3e-20 95 26 14 359 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain SMS-3-5 / SECEC)
Q0TG16 2.68e-20 94 26 12 349 3 mdtA Multidrug resistance protein MdtA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8CVX8 2.84e-20 94 26 12 349 3 mdtA Multidrug resistance protein MdtA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MWY7 3.85e-20 94 26 12 347 3 mdtA Multidrug resistance protein MdtA Escherichia coli O81 (strain ED1a)
B7M457 3.93e-20 94 26 12 347 3 mdtA Multidrug resistance protein MdtA Escherichia coli O8 (strain IAI1)
P76397 4e-20 94 26 12 347 2 mdtA Multidrug resistance protein MdtA Escherichia coli (strain K12)
A8A1U6 4e-20 94 26 12 347 3 mdtA Multidrug resistance protein MdtA Escherichia coli O9:H4 (strain HS)
B1X7H0 4e-20 94 26 12 347 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain K12 / DH10B)
C4ZSG2 4e-20 94 26 12 347 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain K12 / MC4100 / BW2952)
B7UTB2 4e-20 94 26 12 347 3 mdtA Multidrug resistance protein MdtA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7L9U7 8.19e-20 93 26 12 347 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain 55989 / EAEC)
B7LV38 1.29e-19 92 26 12 347 3 mdtA Multidrug resistance protein MdtA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
C5BHN6 2.73e-19 92 26 11 338 3 mdtA Multidrug resistance protein MdtA Edwardsiella ictaluri (strain 93-146)
Q8Z5F8 2.89e-19 92 28 12 359 3 mdtA Multidrug resistance protein MdtA Salmonella typhi
C0Q1F4 2.89e-19 92 28 12 359 3 mdtA Multidrug resistance protein MdtA Salmonella paratyphi C (strain RKS4594)
A1JKX1 3.95e-19 91 26 10 342 3 mdtA Multidrug resistance protein MdtA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8ZNQ3 5.83e-19 90 28 12 359 3 mdtA Multidrug resistance protein MdtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7N3E3 6.39e-19 90 25 10 335 3 mdtA Multidrug resistance protein MdtA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4T9U0 7.75e-19 90 27 12 359 3 mdtA Multidrug resistance protein MdtA Salmonella heidelberg (strain SL476)
Q83KI5 1.33e-18 89 26 11 326 3 mdtA Putative multidrug resistance protein MdtA Shigella flexneri
B1JSD5 5.26e-18 88 26 10 339 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TMR2 5.66e-18 88 26 10 339 3 mdtA Multidrug resistance protein MdtA Yersinia pestis (strain Pestoides F)
Q1CK59 5.66e-18 88 26 10 339 3 mdtA Multidrug resistance protein MdtA Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZCW1 5.66e-18 88 26 10 339 3 mdtA Multidrug resistance protein MdtA Yersinia pestis
Q1C5M1 5.66e-18 88 26 10 339 3 mdtA Multidrug resistance protein MdtA Yersinia pestis bv. Antiqua (strain Antiqua)
Q668C7 5.94e-18 88 26 10 339 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K9L9 5.94e-18 88 26 10 339 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FG18 6.7e-18 88 26 10 339 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q8G2M7 1.66e-17 86 25 11 399 1 bepD Efflux pump periplasmic linker BepD Brucella suis biovar 1 (strain 1330)
Q8FWV8 1.69e-15 80 26 12 366 1 bepF Efflux pump periplasmic linker BepF Brucella suis biovar 1 (strain 1330)
B4EY99 4.76e-15 79 23 9 335 3 mdtA Multidrug resistance protein MdtA Proteus mirabilis (strain HI4320)
P25196 1.41e-14 77 22 6 315 3 nolF Nodulation protein NolF Rhizobium meliloti (strain 1021)
Q8X4L0 1.27e-12 72 24 13 382 3 mdtE Multidrug resistance protein MdtE Escherichia coli O157:H7
P37636 1.42e-12 71 24 13 382 1 mdtE Multidrug resistance protein MdtE Escherichia coli (strain K12)
Q93PU5 2.95e-12 70 24 11 354 2 ttgG Toluene efflux pump periplasmic linker protein TtgG Pseudomonas putida (strain DOT-T1E)
O31099 3e-12 70 24 11 354 2 srpA Solvent efflux pump periplasmic linker SrpA Pseudomonas putida
Q8CVL1 3.39e-12 70 24 13 382 3 mdtE Multidrug resistance protein MdtE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9KWV5 3.72e-11 67 23 9 358 2 ttgD Toluene efflux pump periplasmic linker protein TtgD Pseudomonas putida (strain DOT-T1E)
Q849Q9 3.72e-11 67 23 9 358 3 sepA Probable efflux pump periplasmic linker protein SepA Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P43505 4.33e-11 67 26 13 333 3 mtrC Membrane fusion protein MtrC Neisseria gonorrhoeae
Q9WWZ9 4.63e-10 64 24 11 334 2 ttgA Toluene efflux pump periplasmic linker protein TtgA Pseudomonas putida (strain DOT-T1E)
Q88N30 6.02e-10 63 24 11 334 1 ttgA Probable efflux pump periplasmic linker TtgA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P0C069 6.02e-10 63 24 11 334 1 mepA Multidrug/solvent efflux pump periplasmic linker protein MepA Pseudomonas putida
Q9ZHD0 7.25e-10 63 29 6 191 3 silB Putative membrane fusion protein SilB Salmonella typhimurium
P24180 1.49e-09 62 23 12 380 1 acrE Multidrug export protein AcrE Escherichia coli (strain K12)
Q9KJC3 7.21e-09 60 25 10 316 2 arpA Antibiotic efflux pump periplasmic linker protein ArpA Pseudomonas putida
P52477 1.73e-08 59 22 9 367 1 mexA Multidrug resistance protein MexA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P75830 2.09e-08 58 25 11 329 1 macA Macrolide export protein MacA Escherichia coli (strain K12)
P64177 2.62e-08 58 25 11 329 3 macA Macrolide export protein MacA Shigella flexneri
P64176 2.62e-08 58 25 11 329 3 macA Macrolide export protein MacA Escherichia coli O157:H7
Q88F89 3.07e-08 58 29 5 183 1 pvdR Pyoverdine export membrane fusion protein PvdR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P0AE06 1.42e-07 56 24 11 383 1 acrA Multidrug efflux pump subunit AcrA Escherichia coli (strain K12)
P0AE07 1.42e-07 56 24 11 383 3 acrA Multidrug efflux pump subunit AcrA Escherichia coli O157:H7
P77239 1.78e-07 56 25 4 178 1 cusB Cation efflux system protein CusB Escherichia coli (strain K12)
Q8CWA2 2.29e-07 55 25 4 178 3 cusB Cation efflux system protein CusB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XEH9 5.73e-07 54 25 4 178 3 cusB Cation efflux system protein CusB Escherichia coli O157:H7
P76185 1.68e-06 52 24 3 186 3 ydhJ Uncharacterized protein YdhJ Escherichia coli (strain K12)
P13510 4.17e-06 52 24 10 314 1 czcB Cobalt-zinc-cadmium resistance protein CzcB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q9I191 9.75e-06 50 23 9 345 1 pvdR Pyoverdine export membrane fusion protein PvdR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P58411 1.12e-05 50 21 8 343 3 macA Macrolide export protein MacA Yersinia pestis
Q8ZQP0 1.57e-05 50 18 4 290 3 ybhG UPF0194 membrane protein YbhG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z879 1.57e-05 50 18 4 290 3 ybhG UPF0194 membrane protein YbhG Salmonella typhi
C0PX06 1.57e-05 50 18 4 290 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi C (strain RKS4594)
B5QXS4 1.57e-05 50 18 4 290 3 ybhG UPF0194 membrane protein YbhG Salmonella enteritidis PT4 (strain P125109)
B5FP83 1.57e-05 50 18 4 290 3 ybhG UPF0194 membrane protein YbhG Salmonella dublin (strain CT_02021853)
Q57RE0 1.57e-05 50 18 4 290 3 ybhG UPF0194 membrane protein YbhG Salmonella choleraesuis (strain SC-B67)
B5F095 1.57e-05 50 18 4 290 3 ybhG UPF0194 membrane protein YbhG Salmonella agona (strain SL483)
A9MIT3 1.76e-05 49 18 4 290 3 ybhG UPF0194 membrane protein YbhG Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P94176 5.98e-05 48 23 10 314 3 czcB Cation efflux system protein CzcB Alcaligenes sp. (strain CT14)
B5BC09 6.7e-05 48 18 5 290 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi A (strain AKU_12601)
Q5PG34 6.7e-05 48 18 5 290 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TQW1 7.73e-05 47 18 4 290 3 ybhG UPF0194 membrane protein YbhG Salmonella schwarzengrund (strain CVM19633)
A9MSW1 7.73e-05 47 18 4 290 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T074 7.73e-05 47 18 4 290 3 ybhG UPF0194 membrane protein YbhG Salmonella newport (strain SL254)
B4TC72 7.73e-05 47 18 4 290 3 ybhG UPF0194 membrane protein YbhG Salmonella heidelberg (strain SL476)
O31710 7.85e-05 47 24 14 348 1 yknX Putative efflux system component YknX Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13340
Feature type CDS
Gene -
Product efflux RND transporter periplasmic adaptor subunit
Location 2955880 - 2956986 (strand: 1)
Length 1107 (nucleotides) / 368 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_366
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF16576 Barrel-sandwich domain of CusB or HlyD membrane-fusion

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0845 Cell wall/membrane/envelope biogenesis (M)
Defense mechanisms (V)
MV Multidrug efflux pump subunit AcrA (membrane-fusion protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18306 membrane fusion protein, multidrug efflux system Quorum sensing -

Protein Sequence

MNKKLTLTLCASLFLLSAGAMVYATMGSDEDETQPFAYPPTKVALATAQSAELPNTMHGVGELEAARQVYLAAETNGRIATIHFASGQTVTAGQILVKLNDEPEQAELLRLQAQLTNAEKLYSRTRQLYSKNVAAAAQLDSTLSERDMIVASIREVKARIAQKTIKAPFDGIVGIKLVHEGQYLNAEERVASLVDASHLKLNFSLDEQVAPQLSTHQPINIAVDAYPNQTFTGSLNAIDPLIGPSRTVQVQAILPNTDNKLKAGMFARVQVTSPTRHQALTVPETAVTYTAYGDTVFVAQSDNQKNLIAKRVSVKVGLRYNGLIEIKEGLNQGDQVVTSGQIKLSDGTSIAPIEQDTLTLAQSTTRQP

Flanking regions ( +/- flanking 50bp)

CATAACACCCTAAAAATAGATAAAAACTTCACTATGGGATCGGCGGTAAAATGAATAAGAAATTGACGTTAACTTTATGTGCCTCACTATTTTTATTAAGTGCAGGGGCAATGGTTTATGCAACAATGGGATCTGATGAAGATGAAACACAGCCATTTGCTTATCCACCAACAAAAGTGGCATTAGCAACCGCGCAATCCGCTGAATTACCTAATACCATGCATGGTGTTGGAGAATTGGAAGCCGCTAGACAAGTCTATTTAGCGGCAGAAACAAATGGGCGCATCGCCACGATCCACTTTGCATCAGGACAGACCGTCACCGCGGGACAAATCTTAGTAAAATTAAATGATGAGCCAGAGCAAGCGGAATTATTACGCCTACAAGCACAACTAACTAATGCAGAAAAACTTTATTCAAGAACTCGCCAACTTTATAGTAAAAATGTGGCTGCAGCAGCACAATTAGATAGTACGTTATCAGAGCGCGATATGATTGTAGCCTCTATCCGTGAAGTGAAAGCGCGCATTGCACAAAAAACAATTAAAGCTCCCTTTGATGGTATTGTCGGCATAAAACTCGTGCATGAAGGACAGTATCTAAATGCTGAGGAACGTGTTGCCTCATTAGTGGATGCAAGCCACTTAAAACTTAACTTTTCACTCGATGAGCAAGTGGCGCCACAGCTTTCAACTCATCAACCTATTAATATTGCAGTTGATGCTTATCCTAATCAAACATTTACCGGCTCACTTAATGCCATAGACCCTCTTATTGGCCCTTCTCGCACTGTGCAAGTACAAGCCATTTTACCGAATACCGATAACAAATTAAAAGCGGGCATGTTTGCTCGTGTTCAAGTTACCTCCCCTACTCGTCATCAGGCATTAACCGTACCAGAGACAGCGGTTACTTATACTGCCTATGGGGATACCGTGTTTGTAGCGCAATCTGACAATCAAAAAAACCTTATCGCTAAGCGTGTCTCTGTGAAAGTTGGATTGCGCTACAACGGCCTTATCGAGATCAAAGAAGGCTTAAATCAGGGAGATCAAGTTGTTACCTCAGGACAAATCAAACTTAGTGATGGCACCTCAATAGCCCCCATAGAGCAAGATACGTTAACACTGGCCCAATCTACTACTCGTCAACCATAACAGGAGTGTTTCATGAAATTCACTGATATTTTTGTGCGACGACCTGTTTT