Homologs in group_3841
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| F4V73_RS08375 | F4V73_RS08375 | 27.6 | Morganella psychrotolerans | sctF | type III secretion system needle filament subunit SctF |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P0A224 | 5.07e-15 | 66 | 44 | 0 | 79 | 3 | sctF | Type 3 secretion system needle filament protein | Shigella sonnei |
| P0A223 | 5.07e-15 | 66 | 44 | 0 | 79 | 1 | sctF | Type 3 secretion system needle filament protein | Shigella flexneri |
| P41784 | 2.61e-13 | 62 | 47 | 0 | 65 | 1 | sctF1 | SPI-1 type 3 secretion system needle filament protein | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| O68691 | 3.16e-05 | 41 | 28 | 0 | 73 | 1 | sctF | Type 3 secretion system needle filament protein | Yersinia pestis |
| Q01247 | 0.000283 | 39 | 27 | 0 | 72 | 1 | sctF | Type 3 secretion system needle filament protein | Yersinia enterocolitica |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS13300 |
| Feature type | CDS |
| Gene | sctF |
| Product | type III secretion system needle filament subunit SctF |
| Location | 2951866 - 2952120 (strand: 1) |
| Length | 255 (nucleotides) / 84 (amino acids) |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_3841 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 2 |
| PF09392 | Type III secretion needle MxiH, YscF, SsaG, EprI, PscF, EscF |
|---|
| KO | Description | Pathways | Modules |
|---|---|---|---|
| K03221 | type III secretion protein F | Bacterial secretion system Pathogenic Escherichia coli infection Shigellosis Salmonella infection |
EHEC/EPEC pathogenicity signature, T3SS and effectors |
MAASLVETDVSSISKVDQYFHKPVKTQSYELSEALEALKADTSNAAALAEYQAKLAEYNITRNAQSTSIKVIKDLAMSIIGNMR
ATCAAGCTATGATGAGTAACATAACAAATTTAAGCACAAAGGAGTAATTTATGGCTGCGAGTCTTGTTGAAACAGATGTAAGTTCAATTAGTAAAGTTGACCAATATTTTCATAAACCTGTGAAAACCCAAAGCTATGAGTTATCTGAAGCCTTAGAAGCATTAAAAGCTGATACATCTAATGCCGCGGCATTAGCCGAATATCAAGCCAAACTTGCCGAATATAATATTACACGTAATGCCCAATCTACATCAATCAAAGTCATTAAAGATCTAGCAATGAGTATTATTGGTAATATGCGTTAACATGAGTTTTACGGAGGTTATGTATGGCTATTGCACCTATTATTCCCGTT
