Homologs in group_1440

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09095 FBDBKF_09095 51.0 Morganella morganii S1 recA SOS response regulatory protein OraA/RecX, interacts with RecA
EHELCC_10315 EHELCC_10315 51.0 Morganella morganii S2 recA SOS response regulatory protein OraA/RecX, interacts with RecA
NLDBIP_10660 NLDBIP_10660 51.0 Morganella morganii S4 recA SOS response regulatory protein OraA/RecX, interacts with RecA
LHKJJB_10695 LHKJJB_10695 51.0 Morganella morganii S3 recA SOS response regulatory protein OraA/RecX, interacts with RecA
HKOGLL_13755 HKOGLL_13755 51.0 Morganella morganii S5 recA SOS response regulatory protein OraA/RecX, interacts with RecA
F4V73_RS10855 F4V73_RS10855 51.0 Morganella psychrotolerans - regulatory protein RecX

Distribution of the homologs in the orthogroup group_1440

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1440

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A6TCW0 2.56e-26 100 37 2 153 3 recX Regulatory protein RecX Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A1WXK6 3.14e-26 100 37 1 140 3 recX Regulatory protein RecX Halorhodospira halophila (strain DSM 244 / SL1)
B5XVB7 3.97e-25 97 35 0 151 3 recX Regulatory protein RecX Klebsiella pneumoniae (strain 342)
Q87LR2 4.45e-25 97 41 1 141 3 recX Regulatory protein RecX Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MYT6 4.54e-24 94 41 1 141 3 recX Regulatory protein RecX Vibrio campbellii (strain ATCC BAA-1116)
B2U048 9.25e-24 94 36 0 152 3 recX Regulatory protein RecX Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P33596 2.57e-23 92 36 0 152 1 recX Regulatory protein RecX Escherichia coli (strain K12)
B1IUY1 2.57e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A3H5 2.57e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli O9:H4 (strain HS)
B1XCM6 2.57e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli (strain K12 / DH10B)
C4ZYU3 2.57e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli (strain K12 / MC4100 / BW2952)
B1LQ16 3.4e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli (strain SMS-3-5 / SECEC)
P66001 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Shigella flexneri
Q0T1C4 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Shigella flexneri serotype 5b (strain 8401)
Q1R802 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli (strain UTI89 / UPEC)
B7N6S8 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P65999 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEI2 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AEN8 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli O1:K1 / APEC
B7M9D5 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli O8 (strain IAI1)
B7MYZ5 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli O81 (strain ED1a)
B5Z2A9 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli O157:H7 (strain EC4115 / EHEC)
P66000 3.55e-23 92 36 0 152 1 recX Regulatory protein RecX Escherichia coli O157:H7
B7LEB0 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli (strain 55989 / EAEC)
B7MKG7 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHB6 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZQC7 3.55e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3YYG5 3.71e-23 92 36 0 152 3 recX Regulatory protein RecX Shigella sonnei (strain Ss046)
B0KT21 3.86e-23 92 35 1 144 3 recX Regulatory protein RecX Pseudomonas putida (strain GB-1)
A7MJ39 4.63e-23 92 35 2 156 3 recX Regulatory protein RecX Cronobacter sakazakii (strain ATCC BAA-894)
B6I684 5.41e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia coli (strain SE11)
B7LW31 5.46e-23 92 36 0 152 3 recX Regulatory protein RecX Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8ZMK5 6.22e-23 91 34 0 152 3 recX Regulatory protein RecX Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q1I6B8 6.58e-23 91 34 1 144 3 recX Regulatory protein RecX Pseudomonas entomophila (strain L48)
A9MFY9 6.85e-23 91 34 0 152 3 recX Regulatory protein RecX Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5BEN6 8.14e-23 91 34 0 152 3 recX Regulatory protein RecX Salmonella paratyphi A (strain AKU_12601)
Q5PF16 8.14e-23 91 34 0 152 3 recX Regulatory protein RecX Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A5F9B6 1.09e-22 90 35 1 142 3 recX Regulatory protein RecX Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q8Z4D4 1.1e-22 91 34 0 152 3 recX Regulatory protein RecX Salmonella typhi
A9N0C4 1.1e-22 91 34 0 152 3 recX Regulatory protein RecX Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5RDF3 1.1e-22 91 34 0 152 3 recX Regulatory protein RecX Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV77 1.1e-22 91 34 0 152 3 recX Regulatory protein RecX Salmonella enteritidis PT4 (strain P125109)
B5FSX9 1.1e-22 91 34 0 152 3 recX Regulatory protein RecX Salmonella dublin (strain CT_02021853)
B5F351 1.1e-22 91 34 0 152 3 recX Regulatory protein RecX Salmonella agona (strain SL483)
B4T399 1.22e-22 90 34 0 152 3 recX Regulatory protein RecX Salmonella newport (strain SL254)
B7NSH8 1.29e-22 90 36 0 152 3 recX Regulatory protein RecX Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B4TT05 1.39e-22 90 34 0 152 3 recX Regulatory protein RecX Salmonella schwarzengrund (strain CVM19633)
A4WDQ7 1.44e-22 90 34 0 152 3 recX Regulatory protein RecX Enterobacter sp. (strain 638)
A1JK08 2.66e-22 90 32 1 161 3 recX Regulatory protein RecX Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C3LS34 2.79e-22 89 35 1 142 3 recX Regulatory protein RecX Vibrio cholerae serotype O1 (strain M66-2)
Q56647 2.79e-22 89 35 1 142 3 recX Regulatory protein RecX Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q88ME3 3.22e-22 89 34 1 144 3 recX Regulatory protein RecX Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W7V1 4.96e-22 89 34 1 144 3 recX Regulatory protein RecX Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q31X63 5.17e-22 89 35 0 152 3 recX Regulatory protein RecX Shigella boydii serotype 4 (strain Sb227)
P37860 8.05e-22 88 34 2 144 3 recX Regulatory protein RecX Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V8D2 8.13e-22 88 34 2 144 3 recX Regulatory protein RecX Pseudomonas aeruginosa (strain LESB58)
Q02R88 8.58e-22 88 34 2 144 3 recX Regulatory protein RecX Pseudomonas aeruginosa (strain UCBPP-PA14)
A8GA08 9.7e-22 88 32 1 162 3 recX Regulatory protein RecX Serratia proteamaculans (strain 568)
B4TF12 1.1e-21 88 33 0 152 3 recX Regulatory protein RecX Salmonella heidelberg (strain SL476)
Q57KU5 1.1e-21 88 33 0 152 3 recX Regulatory protein RecX Salmonella choleraesuis (strain SC-B67)
C0PWM1 1.13e-21 88 33 0 152 3 recX Regulatory protein RecX Salmonella paratyphi C (strain RKS4594)
Q7MHR5 1.42e-21 87 37 2 140 3 recX Regulatory protein RecX Vibrio vulnificus (strain YJ016)
Q32CN0 1.9e-21 87 34 0 152 3 recX Regulatory protein RecX Shigella dysenteriae serotype 1 (strain Sd197)
Q8DC50 4.6e-21 86 37 2 140 3 recX Regulatory protein RecX Vibrio vulnificus (strain CMCP6)
Q6D1S9 1.08e-20 85 35 4 157 3 recX Regulatory protein RecX Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q4KHC0 1.22e-20 85 34 1 144 3 recX Regulatory protein RecX Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A6V1H3 1.29e-20 85 33 2 144 3 recX Regulatory protein RecX Pseudomonas aeruginosa (strain PA7)
Q66E69 2.03e-20 85 32 2 170 3 recX Regulatory protein RecX Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FLR8 2.03e-20 85 32 2 170 3 recX Regulatory protein RecX Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q48F95 2.04e-20 85 33 1 144 3 recX Regulatory protein RecX Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1JDA1 2.09e-20 85 34 2 144 3 recX Regulatory protein RecX Pseudomonas putida (strain W619)
Q87XY8 2.13e-20 84 33 1 144 3 recX Regulatory protein RecX Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9RDT9 6.95e-20 83 35 1 144 3 recX Regulatory protein RecX Pseudomonas tolaasii
P37861 8.43e-20 83 34 1 144 3 recX Regulatory protein RecX Pseudomonas fluorescens
C3KDG1 8.89e-20 83 34 1 144 3 recX Regulatory protein RecX Pseudomonas fluorescens (strain SBW25)
A4TQ51 1.85e-19 83 30 1 175 3 recX Regulatory protein RecX Yersinia pestis (strain Pestoides F)
Q1CLL0 1.85e-19 83 30 1 175 3 recX Regulatory protein RecX Yersinia pestis bv. Antiqua (strain Nepal516)
P37867 1.85e-19 83 30 1 175 3 recX Regulatory protein RecX Yersinia pestis
Q1C421 1.85e-19 83 30 1 175 3 recX Regulatory protein RecX Yersinia pestis bv. Antiqua (strain Antiqua)
Q4ZWP2 8.19e-19 80 32 1 144 3 recX Regulatory protein RecX Pseudomonas syringae pv. syringae (strain B728a)
P0A0W7 1.23e-18 80 34 1 145 3 recX Regulatory protein RecX Xanthomonas citri
P0A0W6 1.23e-18 80 34 1 145 3 recX Regulatory protein RecX Xanthomonas axonopodis pv. citri (strain 306)
Q3BUQ8 1.33e-18 80 34 1 145 3 recX Regulatory protein RecX Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A4XWQ3 7.6e-18 78 32 2 144 3 recX Regulatory protein RecX Pseudomonas mendocina (strain ymp)
B4SRB1 9.12e-18 78 33 2 142 3 recX Regulatory protein RecX Stenotrophomonas maltophilia (strain R551-3)
Q6FCG1 1.09e-17 78 34 2 144 3 recX Regulatory protein RecX Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q2P1N0 1.09e-17 78 33 1 144 3 recX Regulatory protein RecX Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q9AP31 1.09e-17 78 33 1 144 3 recX Regulatory protein RecX Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SUC9 1.09e-17 78 33 1 144 3 recX Regulatory protein RecX Xanthomonas oryzae pv. oryzae (strain PXO99A)
B2FL32 2.31e-17 77 33 2 142 3 recX Regulatory protein RecX Stenotrophomonas maltophilia (strain K279a)
Q5WVQ1 3.22e-17 76 33 1 144 3 recX Regulatory protein RecX Legionella pneumophila (strain Lens)
B3GY30 5.51e-17 75 32 4 147 3 recX Regulatory protein RecX Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N1E6 5.51e-17 75 32 4 147 3 recX Regulatory protein RecX Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VNS6 1.66e-16 74 33 4 147 3 recX Regulatory protein RecX Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8P9X1 5.82e-16 73 32 1 143 1 recX Regulatory protein RecX Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RTY2 5.82e-16 73 32 1 143 3 recX Regulatory protein RecX Xanthomonas campestris pv. campestris (strain B100)
Q4UTR5 5.82e-16 73 32 1 143 3 recX Regulatory protein RecX Xanthomonas campestris pv. campestris (strain 8004)
P37864 4.51e-15 70 32 1 144 3 recX Regulatory protein RecX Legionella pneumophila
A5ICV7 4.51e-15 70 32 1 144 3 recX Regulatory protein RecX Legionella pneumophila (strain Corby)
Q5X4B6 4.51e-15 70 32 1 144 3 recX Regulatory protein RecX Legionella pneumophila (strain Paris)
A5UEC2 1.57e-14 69 32 3 143 3 recX Regulatory protein RecX Haemophilus influenzae (strain PittEE)
P43706 3.33e-14 68 32 3 143 3 recX Regulatory protein RecX Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P37862 3.65e-14 68 32 1 119 3 recX Regulatory protein RecX Pseudomonas putida
Q1QZX2 7e-14 67 33 2 135 3 recX Regulatory protein RecX Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A5UHA0 1.74e-13 67 32 3 143 3 recX Regulatory protein RecX Haemophilus influenzae (strain PittGG)
Q4QMV1 1.69e-11 61 31 3 143 3 recX Regulatory protein RecX Haemophilus influenzae (strain 86-028NP)
B3E9Z0 2.67e-11 61 32 6 158 3 recX Regulatory protein RecX Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B1XY02 6.01e-11 60 30 3 140 3 recX Regulatory protein RecX Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q8Y1Y5 9.68e-11 59 28 3 145 3 recX Regulatory protein RecX Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B5EQ48 9.89e-11 59 34 1 94 3 recX Regulatory protein RecX Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J7B0 9.89e-11 59 34 1 94 3 recX Regulatory protein RecX Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A6T203 1.13e-10 59 30 3 146 3 recX Regulatory protein RecX Janthinobacterium sp. (strain Marseille)
Q7NXM0 2.72e-10 58 33 5 147 3 recX Regulatory protein RecX Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B2UGE0 5.31e-10 57 30 5 146 3 recX Regulatory protein RecX Ralstonia pickettii (strain 12J)
Q65QB1 6.27e-10 57 27 3 143 3 recX Regulatory protein RecX Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P37866 3.75e-08 51 35 2 78 3 recX Regulatory protein RecX Acidithiobacillus ferridurans
O86082 1.23e-07 51 29 3 144 3 recX Regulatory protein RecX Herbaspirillum seropedicae
P59207 2.9e-07 50 28 1 100 3 recX Regulatory protein RecX Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B4SEC4 6.95e-07 49 31 4 138 3 recX Regulatory protein RecX Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q8KBK8 2.44e-06 48 28 4 145 3 recX Regulatory protein RecX Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B3EMI1 2.89e-06 47 30 3 144 3 recX Regulatory protein RecX Chlorobium phaeobacteroides (strain BS1)
A1KUS7 3.37e-06 47 32 5 140 3 recX Regulatory protein RecX Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A4G8B2 3.62e-06 47 26 3 146 3 recX Regulatory protein RecX Herminiimonas arsenicoxydans
Q9JTP4 4.91e-06 47 32 5 140 3 recX Regulatory protein RecX Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q6LH46 5.63e-06 48 28 3 108 3 recX Regulatory protein RecX Photobacterium profundum (strain SS9)
Q9JYQ3 5.78e-06 47 32 5 140 3 recX Regulatory protein RecX Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B9DV29 4.27e-05 45 25 4 121 3 recX Regulatory protein RecX Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B4RKR9 0.000117 43 30 5 140 3 recX Regulatory protein RecX Neisseria gonorrhoeae (strain NCCP11945)
Q5F7W3 0.000117 43 30 5 140 3 recX Regulatory protein RecX Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9KEC9 0.000123 44 31 5 130 3 recX Regulatory protein RecX Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8CV64 0.000282 43 29 3 114 3 recX Regulatory protein RecX Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A5IL84 0.000291 42 30 5 149 3 recX Regulatory protein RecX Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B1LAG4 0.000294 42 30 5 149 3 recX Regulatory protein RecX Thermotoga sp. (strain RQ2)
Q9X2H3 0.000294 42 30 5 149 3 recX Regulatory protein RecX Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q5L2U3 0.000696 42 28 6 152 3 recX Regulatory protein RecX Geobacillus kaustophilus (strain HTA426)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13120
Feature type CDS
Gene -
Product regulatory protein RecX
Location 2912650 - 2913111 (strand: -1)
Length 462 (nucleotides) / 153 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1440
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02631 RecX, second three-helix domain
PF21981 RecX, third three-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2137 Posttranslational modification, protein turnover, chaperones (O) O SOS response regulatory protein OraA/RecX, interacts with RecA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03565 regulatory protein - -

Protein Sequence

MTYDELYQYAIFMLSRRDYGTTELKRRLARRINEVDKAKQSTTDERCLEQVIERLLEGQYLDDNRTVYAFFRRYLSKSYGPLRIRQELRQKGFPSEIIARVLEETETDWYALCQDLKEKKFGTGKPKDFKERAKQIRYLQYRGFTSDYINALF

Flanking regions ( +/- flanking 50bp)

TAAGATATGCAGGATACCAAACTGGGGTGCAATAACATTAAGGAGTTGCGATGACTTATGATGAATTATACCAATACGCTATATTTATGTTGTCGCGTCGTGATTATGGTACCACTGAGCTGAAACGCCGTTTAGCACGAAGGATCAACGAAGTCGATAAAGCTAAACAGAGCACAACCGATGAAAGATGCTTAGAGCAAGTGATCGAGCGATTATTAGAAGGCCAATATCTGGATGATAATCGCACGGTATATGCTTTTTTTCGTCGTTATTTAAGTAAATCTTATGGCCCGCTGCGTATTCGCCAAGAGTTACGGCAAAAAGGCTTTCCCAGTGAAATTATTGCACGGGTACTAGAAGAAACAGAAACTGATTGGTATGCACTCTGCCAAGATCTTAAAGAGAAAAAATTTGGTACAGGTAAACCCAAAGATTTTAAAGAAAGAGCGAAACAGATCCGCTATCTCCAATATCGAGGGTTTACTTCTGATTATATCAATGCGTTATTTTAATTGATTAACGAAGTGCCATGGCATATTTATCATCAAACTAATTTTTATAA