Homologs in group_2358

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17980 FBDBKF_17980 100.0 Morganella morganii S1 - Fimbria/pilus periplasmic chaperone
EHELCC_06355 EHELCC_06355 100.0 Morganella morganii S2 - Fimbria/pilus periplasmic chaperone
NLDBIP_06675 NLDBIP_06675 100.0 Morganella morganii S4 - Fimbria/pilus periplasmic chaperone
LHKJJB_19275 LHKJJB_19275 100.0 Morganella morganii S3 - Fimbria/pilus periplasmic chaperone
HKOGLL_04715 HKOGLL_04715 100.0 Morganella morganii S5 - Fimbria/pilus periplasmic chaperone
PMI_RS02645 PMI_RS02645 55.6 Proteus mirabilis HI4320 - fimbria/pilus periplasmic chaperone

Distribution of the homologs in the orthogroup group_2358

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2358

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45991 1.47e-38 135 39 6 187 3 hifB Chaperone protein HifB Haemophilus influenzae
P35757 8.42e-38 133 39 6 187 3 hifB Chaperone protein HifB Haemophilus influenzae
P33128 1.2e-35 127 38 4 183 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
P33409 4.76e-30 113 35 5 184 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P42914 2.16e-24 98 33 4 172 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
P21646 2.37e-22 93 34 7 182 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
P77249 2.89e-21 90 36 6 163 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
Q8X5K6 4.3e-21 89 30 4 171 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P37923 5.21e-21 89 36 7 173 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P43661 7.89e-20 86 30 4 165 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P25402 1.01e-19 86 32 6 169 3 fanE Chaperone protein FanE Escherichia coli
P62609 8.14e-18 80 32 5 164 1 focC Chaperone protein FocC Escherichia coli
P62610 8.14e-18 80 32 5 164 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P46004 1.86e-17 80 32 6 173 3 aggD Chaperone protein AggD Escherichia coli
P33342 3.74e-17 79 29 6 184 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P53520 6.98e-17 79 32 8 178 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P26926 2.76e-16 77 28 6 174 1 caf1M Chaperone protein caf1M Yersinia pestis
P33407 1.39e-15 75 28 6 175 3 myfB Chaperone protein MyfB Yersinia enterocolitica
P31697 1.51e-14 72 31 7 167 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
P59590 1.69e-14 72 31 7 167 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69966 6.54e-14 71 29 6 179 3 psaB Chaperone protein PsaB Yersinia pseudotuberculosis serotype I (strain IP32953)
P69965 6.54e-14 71 29 6 179 3 psaB Chaperone protein PsaB Yersinia pestis
Q8X5E4 1.72e-13 69 27 4 165 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
Q05433 2.14e-13 69 27 7 169 3 clpE Chaperone protein ClpE Escherichia coli
P75856 4.88e-13 68 27 4 165 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
P25401 4.97e-13 68 27 7 169 1 faeE Chaperone protein FaeE Escherichia coli
P53516 1.01e-12 67 29 4 157 3 afaB Chaperone protein AfaB Escherichia coli
P53519 1.65e-11 64 27 4 173 3 cssC Chaperone protein CssC Escherichia coli
P53518 5.36e-11 62 26 4 173 3 cssC Chaperone protein CssC Escherichia coli
P75749 6.87e-11 62 26 6 178 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
P15319 1.44e-10 61 26 5 168 1 papD Chaperone protein PapD Escherichia coli
P40876 2.81e-10 60 30 6 155 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P15483 9.15e-09 56 25 4 168 3 None Chaperone protein CS3-1 Escherichia coli
P46738 1.24e-08 56 28 4 157 3 nfaE Chaperone protein NfaE Escherichia coli
P77599 8.09e-07 51 25 11 175 2 yfcS Probable fimbrial chaperone YfcS Escherichia coli (strain K12)
P77616 7.69e-05 45 28 12 180 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
P33387 0.000251 43 26 7 172 3 sefB Chaperone protein SefB Salmonella enteritidis

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS12925
Feature type CDS
Gene -
Product fimbria/pilus periplasmic chaperone
Location 2868545 - 2869114 (strand: -1)
Length 570 (nucleotides) / 189 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2358
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain
PF02753 Pili assembly chaperone PapD, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Protein Sequence

MDTGDASVAPDSVNVPFIITPLIFRIEPHTGQTLRIMYTGEALPNDRESIFWLNILDISAKPKFENKNNLNVNSNYLQLPIHSRIKLFYRPEKLTRSLSEAYNSVIWHIEKQGAKAFLCADNQSPYFITYNHITLIQSNYSQSINPVDMVAPYSSIRLPIHGNMSGYGKVKWTVVNDYGGHELSESALK

Flanking regions ( +/- flanking 50bp)

ATATTAAAATTAATAATGATGAATCTACTCCATCTTTAATTCAGTCCTGGATTGATACTGGTGATGCCAGTGTTGCTCCAGACTCAGTCAATGTTCCCTTTATTATTACTCCGCTTATATTTCGTATAGAACCTCACACAGGGCAAACATTACGAATTATGTATACGGGTGAAGCACTGCCTAATGATCGTGAATCAATTTTTTGGCTAAATATACTGGATATTTCAGCTAAACCTAAATTTGAAAATAAAAATAATTTAAATGTAAACTCAAATTATCTTCAACTCCCGATCCATAGTCGCATAAAGCTATTCTATCGTCCAGAAAAACTCACACGTTCTCTCAGTGAGGCCTATAATTCTGTTATATGGCATATTGAAAAACAAGGAGCAAAGGCCTTTCTTTGTGCAGATAATCAAAGTCCTTATTTTATTACTTATAATCATATTACTTTGATTCAGAGCAACTACTCACAATCAATTAATCCAGTAGATATGGTTGCTCCTTATTCTTCAATACGCCTTCCTATACATGGAAATATGTCGGGATATGGAAAAGTGAAGTGGACAGTTGTTAACGATTATGGTGGGCATGAATTAAGTGAGTCAGCTCTGAAATAAGGATAATATTTATGAAATATTGCACTTAAACTGAACATCATTCATTCCTG