Homologs in group_2639

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04010 FBDBKF_04010 99.1 Morganella morganii S1 - Integrative conjugative element protein, RAQPRD family
EHELCC_06525 EHELCC_06525 99.1 Morganella morganii S2 - Integrative conjugative element protein, RAQPRD family
NLDBIP_06850 NLDBIP_06850 99.1 Morganella morganii S4 - Integrative conjugative element protein, RAQPRD family
LHKJJB_06385 LHKJJB_06385 99.1 Morganella morganii S3 - Integrative conjugative element protein, RAQPRD family
HKOGLL_04545 HKOGLL_04545 99.1 Morganella morganii S5 - Integrative conjugative element protein, RAQPRD family

Distribution of the homologs in the orthogroup group_2639

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2639

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS12765
Feature type CDS
Gene -
Product RAQPRD family integrative conjugative element protein
Location 2822166 - 2822492 (strand: -1)
Length 327 (nucleotides) / 108 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2639
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF09686 Plasmid protein of unknown function (Plasmid_RAQPRD)

Protein Sequence

MRLFSPLISLFALVVSAFGVLPAQAAEKDELALTLKQLDHIQASLERARIQANQDNHARFYFDYSRASREVEIIRQGIVRYLEPSRAQPTVPVNVAEPLRGDYRREQR

Flanking regions ( +/- flanking 50bp)

GTCCGCCTTTTTTACCCTGACTCCACGTTAACCGTCTTTAAGGAGTCGTTATGCGATTATTTTCTCCGCTTATTTCCCTGTTTGCGTTGGTTGTCAGTGCATTTGGGGTATTGCCTGCTCAGGCCGCTGAAAAAGATGAACTGGCGCTGACGTTAAAGCAGCTCGATCACATCCAGGCCAGCCTGGAGCGCGCCCGTATTCAGGCAAATCAGGACAATCACGCCCGTTTTTATTTTGATTATTCCCGCGCCTCCAGAGAGGTGGAGATTATCCGGCAGGGGATTGTCCGCTATCTGGAGCCTTCCCGGGCCCAGCCCACGGTGCCGGTTAATGTGGCGGAGCCGCTGCGCGGGGATTACCGCCGGGAGCAGCGATGAATCCGTCACAGCAGGCGGCATTTGAGGCTGCTGCCGGCTCGGGGATGTCT