Homologs in group_2667

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04010 FBDBKF_04010 100.0 Morganella morganii S1 - Integrative conjugative element protein, RAQPRD family
EHELCC_06525 EHELCC_06525 100.0 Morganella morganii S2 - Integrative conjugative element protein, RAQPRD family
NLDBIP_06850 NLDBIP_06850 100.0 Morganella morganii S4 - Integrative conjugative element protein, RAQPRD family
LHKJJB_06385 LHKJJB_06385 100.0 Morganella morganii S3 - Integrative conjugative element protein, RAQPRD family
PMI_RS12765 PMI_RS12765 99.1 Proteus mirabilis HI4320 - RAQPRD family integrative conjugative element protein

Distribution of the homologs in the orthogroup group_2667

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2667

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_04545
Feature type CDS
Gene -
Product Integrative conjugative element protein, RAQPRD family
Location 221907 - 222233 (strand: -1)
Length 327 (nucleotides) / 108 (amino acids)
In genomic island -

Contig

Accession ZDB_681
Length 269562 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2667
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF09686 Plasmid protein of unknown function (Plasmid_RAQPRD)

Protein Sequence

MRLFSPLISLFALVVSAFGVLPAQAAEKDELALTLKQLDHIQASLERARIQANQDNHARFYFDYSRASREVEIIRQGIVRYLEPSRAQPTMPVNVAEPLRGDYRREQR

Flanking regions ( +/- flanking 50bp)

GTCCGCCTTTTTTACCCTGACTCCACGTTAACCGTCTTTAAGGAGTCGTTATGCGATTATTTTCTCCGCTTATTTCCCTGTTTGCGTTGGTTGTCAGTGCATTTGGGGTATTGCCTGCTCAGGCCGCTGAAAAAGATGAACTGGCGCTGACGTTAAAGCAGCTCGATCACATCCAGGCCAGCCTGGAGCGCGCCCGTATTCAGGCAAATCAGGACAATCACGCCCGTTTTTATTTTGATTATTCCCGCGCCTCCAGAGAGGTGGAGATTATCCGGCAGGGGATTGTCCGCTATCTGGAGCCTTCCCGGGCCCAGCCCACGATGCCGGTTAATGTGGCGGAGCCGCTGCGCGGGGATTACCGCCGGGAGCAGCGATGAATCCGTCACAGCAGGCGGCATTTGAGGCTGCTGCCGGCTCGGGGATGTCT