Homologs in group_2351

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17810 FBDBKF_17810 57.0 Morganella morganii S1 rsmC 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC
EHELCC_09835 EHELCC_09835 57.0 Morganella morganii S2 rsmC 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC
NLDBIP_10215 NLDBIP_10215 57.0 Morganella morganii S4 rsmC 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC
LHKJJB_07540 LHKJJB_07540 57.0 Morganella morganii S3 rsmC 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC
HKOGLL_07090 HKOGLL_07090 57.0 Morganella morganii S5 rsmC 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC
F4V73_RS15155 F4V73_RS15155 56.1 Morganella psychrotolerans rsmC 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC

Distribution of the homologs in the orthogroup group_2351

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2351

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EWW4 0.0 700 100 0 337 3 rsmC Ribosomal RNA small subunit methyltransferase C Proteus mirabilis (strain HI4320)
Q7MZN0 1.13e-167 473 64 0 337 3 rsmC Ribosomal RNA small subunit methyltransferase C Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8G9G5 6.22e-145 416 60 0 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Serratia proteamaculans (strain 568)
Q6D984 5.35e-142 408 60 0 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q66EW9 2.71e-139 401 58 0 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3H9 2.71e-139 401 58 0 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A1JJ89 5.81e-139 400 57 0 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JL46 6.07e-139 400 58 0 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TQK1 6.07e-139 400 58 0 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pestis (strain Pestoides F)
Q1CN00 6.07e-139 400 58 0 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pestis bv. Antiqua (strain Nepal516)
A9R058 6.07e-139 400 58 0 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pestis bv. Antiqua (strain Angola)
Q7CG56 6.07e-139 400 58 0 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pestis
Q1C153 6.07e-139 400 58 0 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMI4 6.07e-139 400 58 0 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A7MGA7 4.54e-134 388 55 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Cronobacter sakazakii (strain ATCC BAA-894)
B7NVD9 4.76e-133 385 55 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1LEH4 5.92e-133 385 55 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain SMS-3-5 / SECEC)
Q8FA64 7.86e-133 385 55 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T8U3 1.01e-132 384 55 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MTB6 1.22e-132 384 55 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O81 (strain ED1a)
B2VH94 1.65e-132 384 55 0 336 3 rsmC Ribosomal RNA small subunit methyltransferase C Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B7LNK6 2.42e-132 383 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1IS49 7.14e-132 382 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q1R2D5 9.38e-132 382 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain UTI89 / UPEC)
A1AJP2 9.38e-132 382 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O1:K1 / APEC
B7LEL6 1.11e-131 382 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain 55989 / EAEC)
B6I2Q2 1.15e-131 382 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain SE11)
A8A899 1.15e-131 382 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O9:H4 (strain HS)
B7LXT2 1.15e-131 382 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O8 (strain IAI1)
A7ZVR0 1.15e-131 382 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O139:H28 (strain E24377A / ETEC)
Q327M6 1.18e-131 382 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Shigella dysenteriae serotype 1 (strain Sd197)
P39406 1.18e-131 382 54 0 334 1 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain K12)
B1XFI0 1.18e-131 382 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain K12 / DH10B)
B7MNC1 1.18e-131 382 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3YU23 2.08e-131 381 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Shigella sonnei (strain Ss046)
Q820Z6 3.88e-131 380 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Shigella flexneri
B5Z4Q2 1.21e-130 379 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X510 1.21e-130 379 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O157:H7
B7NH38 1.44e-130 379 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q31SW8 2.38e-130 378 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Shigella boydii serotype 4 (strain Sb227)
B2TZQ2 6.15e-130 377 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5BL07 1.06e-129 377 54 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella paratyphi A (strain AKU_12601)
Q5PK16 1.06e-129 377 54 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q0SX40 4.43e-129 375 54 0 334 3 rsmC Ribosomal RNA small subunit methyltransferase C Shigella flexneri serotype 5b (strain 8401)
B4TU29 5.33e-129 375 53 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella schwarzengrund (strain CVM19633)
B5F512 5.33e-129 375 53 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella agona (strain SL483)
Q8Z0V2 5.45e-129 375 53 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella typhi
B5Y286 1.62e-128 374 54 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Klebsiella pneumoniae (strain 342)
A4W687 1.13e-127 372 54 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Enterobacter sp. (strain 638)
B4TGY8 1.98e-127 371 53 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella heidelberg (strain SL476)
B4T4F9 2.6e-127 370 52 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella newport (strain SL254)
Q8ZJW6 6.36e-127 370 53 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5R2I6 6.36e-127 370 53 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella enteritidis PT4 (strain P125109)
B5FTB3 6.36e-127 370 53 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella dublin (strain CT_02021853)
Q57G51 1.4e-126 369 53 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella choleraesuis (strain SC-B67)
A8ALZ1 4.84e-126 367 52 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9N7C4 1.11e-125 366 52 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5R9T9 4.49e-125 365 52 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q2NW11 9.31e-125 364 52 1 338 3 rsmC Ribosomal RNA small subunit methyltransferase C Sodalis glossinidius (strain morsitans)
A9MRB9 2.72e-124 363 52 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6THY6 2.04e-122 358 54 0 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C4K8X0 6.66e-119 349 48 0 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B3GZF1 1.94e-99 299 45 4 339 3 rsmC Ribosomal RNA small subunit methyltransferase C Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BU33 9.39e-99 297 45 5 342 3 rsmC Ribosomal RNA small subunit methyltransferase C Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N3U3 3.43e-98 296 45 4 339 3 rsmC Ribosomal RNA small subunit methyltransferase C Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q65S65 4.55e-97 293 46 5 336 3 rsmC Ribosomal RNA small subunit methyltransferase C Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VMV4 6.49e-94 285 45 6 344 3 rsmC Ribosomal RNA small subunit methyltransferase C Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7VP87 1.68e-91 279 42 4 333 3 rsmC Ribosomal RNA small subunit methyltransferase C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q4QPN2 1.89e-91 279 42 4 339 3 rsmC Ribosomal RNA small subunit methyltransferase C Haemophilus influenzae (strain 86-028NP)
Q9CM79 1.97e-91 279 43 4 339 3 rsmC Ribosomal RNA small subunit methyltransferase C Pasteurella multocida (strain Pm70)
P44453 8e-91 277 41 4 339 3 rsmC Ribosomal RNA small subunit methyltransferase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UFI6 8.63e-91 277 41 4 339 3 rsmC Ribosomal RNA small subunit methyltransferase C Haemophilus influenzae (strain PittGG)
A5UBC5 2.44e-88 271 41 4 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Haemophilus influenzae (strain PittEE)
Q8DBY0 1.88e-87 269 41 6 345 3 rsmC Ribosomal RNA small subunit methyltransferase C Vibrio vulnificus (strain CMCP6)
Q87LY1 1.8e-85 264 41 5 343 3 rsmC Ribosomal RNA small subunit methyltransferase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MHY6 1.88e-85 264 40 6 345 3 rsmC Ribosomal RNA small subunit methyltransferase C Vibrio vulnificus (strain YJ016)
A7MUT5 3.42e-85 263 40 5 343 3 rsmC Ribosomal RNA small subunit methyltransferase C Vibrio campbellii (strain ATCC BAA-1116)
Q9KUA0 4.54e-83 258 40 6 345 3 rsmC Ribosomal RNA small subunit methyltransferase C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F942 4.54e-83 258 40 6 345 3 rsmC Ribosomal RNA small subunit methyltransferase C Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B5FAM0 6.19e-82 255 40 5 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Aliivibrio fischeri (strain MJ11)
Q5E2W4 1.26e-81 254 40 5 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EL06 2.88e-81 253 39 5 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Aliivibrio salmonicida (strain LFI1238)
Q6LUS5 1.98e-80 251 39 5 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Photobacterium profundum (strain SS9)
A0KPP9 1.03e-75 239 41 7 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q8K9L5 1.65e-74 236 36 0 331 3 rsmC Ribosomal RNA small subunit methyltransferase C Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A4SIE3 5.16e-74 234 40 7 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Aeromonas salmonicida (strain A449)
P57413 7.88e-71 226 36 1 336 3 rsmC Ribosomal RNA small subunit methyltransferase C Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A1SZ19 2.02e-66 215 36 4 342 3 rsmC Ribosomal RNA small subunit methyltransferase C Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A4VIL0 4.52e-60 198 35 6 340 3 rsmC Ribosomal RNA small subunit methyltransferase C Stutzerimonas stutzeri (strain A1501)
A5VYJ3 3.78e-59 196 34 6 340 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q4K6D2 5.4e-58 193 36 7 337 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A8H038 3.4e-57 191 36 8 345 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B1JEN3 3.5e-57 191 34 8 343 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas putida (strain W619)
Q1IEU2 3.96e-57 191 34 7 340 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas entomophila (strain L48)
Q47VN0 4.1e-57 192 40 3 265 3 rsmC Ribosomal RNA small subunit methyltransferase C Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q88PT7 4.7e-57 191 34 6 340 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A6VC20 3.44e-56 188 35 5 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas aeruginosa (strain PA7)
Q12JX1 3.69e-56 189 36 7 345 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B0KNH3 1.19e-55 187 34 8 342 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas putida (strain GB-1)
Q057M1 3.3e-55 186 31 0 332 3 rsmC Ribosomal RNA small subunit methyltransferase C Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B8CUC9 5.33e-54 183 34 8 346 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella piezotolerans (strain WP3 / JCM 13877)
Q3K705 7.61e-54 182 35 8 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas fluorescens (strain Pf0-1)
B0TSU8 8.48e-54 182 35 8 345 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella halifaxensis (strain HAW-EB4)
Q3ILJ2 1.77e-53 182 31 6 346 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudoalteromonas translucida (strain TAC 125)
B1KHR8 1.86e-53 182 35 8 342 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella woodyi (strain ATCC 51908 / MS32)
Q02G49 1.97e-53 181 35 5 339 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas aeruginosa (strain UCBPP-PA14)
Q4ZXT0 3.32e-53 181 34 5 338 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas syringae pv. syringae (strain B728a)
Q9HVG4 1.17e-52 179 35 5 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V0H2 1.42e-52 179 35 5 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas aeruginosa (strain LESB58)
Q89AI2 3.31e-52 178 34 2 275 3 rsmC Ribosomal RNA small subunit methyltransferase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q887Y4 1.44e-51 176 33 6 340 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A3QHZ8 5.39e-51 175 34 9 350 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q1QUF2 6.08e-51 175 37 5 262 3 rsmC Ribosomal RNA small subunit methyltransferase C Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A4XYJ7 8.94e-51 174 33 8 345 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas mendocina (strain ymp)
Q48MR4 1.03e-50 174 33 8 351 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q15ZS7 3.3e-50 173 33 6 342 3 rsmC Ribosomal RNA small subunit methyltransferase C Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A8G0F9 6.25e-50 172 34 8 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella sediminis (strain HAW-EB3)
B4S2L3 1.41e-49 172 38 3 265 3 rsmC Ribosomal RNA small subunit methyltransferase C Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q2SJX3 4.45e-48 167 31 7 347 3 rsmC Ribosomal RNA small subunit methyltransferase C Hahella chejuensis (strain KCTC 2396)
A1S321 6.85e-48 167 32 8 346 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0HMF0 1.04e-47 167 34 8 339 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella sp. (strain MR-4)
Q0HRD8 1.06e-47 167 34 9 340 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella sp. (strain MR-7)
Q6FE96 2.5e-47 166 31 8 345 3 rsmC Ribosomal RNA small subunit methyltransferase C Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A0L0V1 5.05e-47 165 33 8 339 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella sp. (strain ANA-3)
A9L1V0 7.59e-47 164 33 7 342 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella baltica (strain OS195)
A6WJH4 9.58e-47 164 33 7 342 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella baltica (strain OS185)
A3D8E4 1.09e-46 164 33 7 342 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella baltica (strain OS155 / ATCC BAA-1091)
A3M8J9 1.85e-46 163 33 8 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HYF8 2.01e-46 163 33 8 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Acinetobacter baumannii (strain ACICU)
B0VRJ4 2.19e-46 163 33 8 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Acinetobacter baumannii (strain SDF)
A1RG35 2.73e-46 163 33 7 342 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella sp. (strain W3-18-1)
A4YA93 2.73e-46 163 33 7 342 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EIL1 4.29e-46 162 34 9 340 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q088B4 3.48e-45 160 32 8 342 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella frigidimarina (strain NCIMB 400)
B0V4Z1 3.78e-45 160 32 8 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Acinetobacter baumannii (strain AYE)
B7GWT8 3.78e-45 160 32 8 341 3 rsmC Ribosomal RNA small subunit methyltransferase C Acinetobacter baumannii (strain AB307-0294)
Q0VP64 6.56e-43 154 29 5 335 3 rsmC Ribosomal RNA small subunit methyltransferase C Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1U204 1.27e-40 148 30 9 351 3 rsmC Ribosomal RNA small subunit methyltransferase C Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A6VRG3 7.83e-37 138 33 6 273 3 rsmC Ribosomal RNA small subunit methyltransferase C Marinomonas sp. (strain MWYL1)
Q5R049 1.09e-36 137 32 5 270 3 rsmC Ribosomal RNA small subunit methyltransferase C Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0VPK2 2.89e-24 105 30 6 269 3 rlmG Ribosomal RNA large subunit methyltransferase G Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7MIC5 1.57e-21 97 29 8 269 3 rlmG Ribosomal RNA large subunit methyltransferase G Vibrio vulnificus (strain YJ016)
Q8DBJ8 1.57e-21 97 29 8 269 3 rlmG Ribosomal RNA large subunit methyltransferase G Vibrio vulnificus (strain CMCP6)
Q5E6X8 4.18e-21 96 27 7 270 3 rlmG Ribosomal RNA large subunit methyltransferase G Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EIC1 5.39e-21 95 27 7 270 3 rlmG Ribosomal RNA large subunit methyltransferase G Aliivibrio salmonicida (strain LFI1238)
B5FBH8 5.39e-21 95 27 7 270 3 rlmG Ribosomal RNA large subunit methyltransferase G Aliivibrio fischeri (strain MJ11)
A7MIS8 9.67e-21 95 33 2 168 3 rlmG Ribosomal RNA large subunit methyltransferase G Cronobacter sakazakii (strain ATCC BAA-894)
B1LFI2 1.01e-20 95 27 8 351 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli (strain SMS-3-5 / SECEC)
Q0TD22 1.01e-20 95 27 8 351 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q821A5 1.14e-20 95 32 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Shigella flexneri
Q0T0I4 1.27e-20 94 32 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Shigella flexneri serotype 5b (strain 8401)
P42596 1.46e-20 94 32 2 176 1 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli (strain K12)
B1IRN3 1.46e-20 94 32 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XG88 1.46e-20 94 32 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli (strain K12 / DH10B)
Q3YXQ6 1.62e-20 94 32 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Shigella sonnei (strain Ss046)
Q31WU9 1.62e-20 94 32 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Shigella boydii serotype 4 (strain Sb227)
Q1R6P6 1.64e-20 94 27 8 351 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli (strain UTI89 / UPEC)
Q8FDE5 1.64e-20 94 27 8 351 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AG02 1.64e-20 94 27 8 351 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O1:K1 / APEC
B5YRC4 1.66e-20 94 32 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAK8 1.66e-20 94 32 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O157:H7
Q32BN8 1.67e-20 94 32 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Shigella dysenteriae serotype 1 (strain Sd197)
Q9KPR9 3.18e-20 93 30 8 261 3 rlmG Ribosomal RNA large subunit methyltransferase G Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5X3 3.18e-20 93 30 8 261 3 rlmG Ribosomal RNA large subunit methyltransferase G Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A8A4P1 4.26e-20 93 32 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O9:H4 (strain HS)
A4WER8 4.42e-20 93 29 5 251 3 rlmG Ribosomal RNA large subunit methyltransferase G Enterobacter sp. (strain 638)
A8APY0 7.33e-20 92 32 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2U1T3 1.15e-19 92 32 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q57JN9 1.47e-19 91 26 9 350 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella choleraesuis (strain SC-B67)
B5F6B6 1.47e-19 91 26 9 350 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella agona (strain SL483)
A1S8P4 1.51e-19 91 29 7 278 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A9N601 1.79e-19 91 26 9 350 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A7ZRW7 1.79e-19 91 31 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O139:H28 (strain E24377A / ETEC)
B4T690 2.11e-19 91 26 9 350 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella newport (strain SL254)
Q87MA4 2.47e-19 91 32 4 179 3 rlmG Ribosomal RNA large subunit methyltransferase G Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B4TIU8 5.88e-19 90 26 10 353 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella heidelberg (strain SL476)
B5QZ55 6.93e-19 89 26 9 350 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella enteritidis PT4 (strain P125109)
B5FHV5 6.93e-19 89 26 9 350 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella dublin (strain CT_02021853)
B5REH7 7e-19 89 25 8 347 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q8ZLX5 7.34e-19 89 26 9 350 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TVV4 7.34e-19 89 26 9 350 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella schwarzengrund (strain CVM19633)
B5BG31 7.34e-19 89 26 9 350 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella paratyphi A (strain AKU_12601)
Q5PC93 7.34e-19 89 26 9 350 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q9K3L9 1.72e-18 88 27 4 273 3 rlmG Ribosomal RNA large subunit methyltransferase G Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8Z3L8 2.14e-18 88 26 10 352 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella typhi
Q6LTZ3 2.21e-18 88 27 7 260 3 rlmG Ribosomal RNA large subunit methyltransferase G Photobacterium profundum (strain SS9)
Q3IHQ6 2.32e-18 88 29 4 178 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudoalteromonas translucida (strain TAC 125)
A9MPU2 2.33e-18 88 31 2 174 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q15YR1 3.06e-18 88 28 5 257 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A7N1U8 3.59e-18 87 26 11 329 3 rlmG Ribosomal RNA large subunit methyltransferase G Vibrio campbellii (strain ATCC BAA-1116)
B7VKD0 3.67e-18 87 26 7 270 3 rlmG Ribosomal RNA large subunit methyltransferase G Vibrio atlanticus (strain LGP32)
B1JLA4 5.01e-18 87 25 7 347 3 rlmG Ribosomal RNA large subunit methyltransferase G Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665P6 5.01e-18 87 25 7 347 3 rlmG Ribosomal RNA large subunit methyltransferase G Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CMJ1 5.01e-18 87 25 7 347 3 rlmG Ribosomal RNA large subunit methyltransferase G Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1N3 5.01e-18 87 25 7 347 3 rlmG Ribosomal RNA large subunit methyltransferase G Yersinia pestis bv. Antiqua (strain Angola)
Q0WJ78 5.01e-18 87 25 7 347 3 rlmG Ribosomal RNA large subunit methyltransferase G Yersinia pestis
B2K3B8 5.01e-18 87 25 7 347 3 rlmG Ribosomal RNA large subunit methyltransferase G Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C310 5.01e-18 87 25 7 347 3 rlmG Ribosomal RNA large subunit methyltransferase G Yersinia pestis bv. Antiqua (strain Antiqua)
A7FE15 5.01e-18 87 25 7 347 3 rlmG Ribosomal RNA large subunit methyltransferase G Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VDD5 6.81e-18 87 24 11 358 3 rlmG Ribosomal RNA large subunit methyltransferase G Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4THM8 7.55e-18 87 25 7 347 3 rlmG Ribosomal RNA large subunit methyltransferase G Yersinia pestis (strain Pestoides F)
A8GJW6 2.61e-17 85 26 10 357 3 rlmG Ribosomal RNA large subunit methyltransferase G Serratia proteamaculans (strain 568)
Q12K11 7.73e-17 84 27 5 270 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q82N59 1.22e-16 83 26 5 275 3 rlmG Ribosomal RNA large subunit methyltransferase G Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A4Y3Y0 1.42e-16 83 28 7 266 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q6D9G1 1.87e-16 82 31 1 167 3 rlmG Ribosomal RNA large subunit methyltransferase G Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4SQM2 2.23e-16 82 32 3 170 3 rlmG Ribosomal RNA large subunit methyltransferase G Aeromonas salmonicida (strain A449)
A3QH04 3.35e-16 82 26 4 268 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1JR10 3.44e-16 82 31 2 168 3 rlmG Ribosomal RNA large subunit methyltransferase G Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1VMX8 6.2e-16 81 24 6 335 3 rlmG Ribosomal RNA large subunit methyltransferase G Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
A1SX22 6.6e-16 81 29 1 169 3 rlmG Ribosomal RNA large subunit methyltransferase G Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q488Q3 8.72e-16 80 24 8 308 3 rlmG Ribosomal RNA large subunit methyltransferase G Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q8EHW5 8.73e-16 80 30 2 176 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0TR07 1.57e-15 80 25 5 285 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella halifaxensis (strain HAW-EB4)
A3D130 1.69e-15 80 28 7 266 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella baltica (strain OS155 / ATCC BAA-1091)
A6TEC2 2.23e-15 79 27 6 255 3 rlmG Ribosomal RNA large subunit methyltransferase G Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A9L0V0 3.79e-15 79 29 3 184 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella baltica (strain OS195)
A6WRY2 4.29e-15 79 29 3 184 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella baltica (strain OS185)
B5XTX7 4.83e-15 78 27 6 255 3 rlmG Ribosomal RNA large subunit methyltransferase G Klebsiella pneumoniae (strain 342)
A8H786 6.79e-15 78 25 4 265 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B1KD54 7.16e-15 78 23 5 292 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella woodyi (strain ATCC 51908 / MS32)
Q07YH6 7.7e-15 78 26 5 279 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella frigidimarina (strain NCIMB 400)
A1RN12 9.71e-15 77 29 3 184 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella sp. (strain W3-18-1)
A0KHC4 1.44e-14 77 30 3 179 3 rlmG Ribosomal RNA large subunit methyltransferase G Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q0HY38 6.96e-14 75 29 2 178 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella sp. (strain MR-7)
A0L9S5 7.88e-14 75 28 8 250 3 rlmG Ribosomal RNA large subunit methyltransferase G Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A8FYW7 1.14e-13 74 25 4 270 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella sediminis (strain HAW-EB3)
A0KTP8 1.52e-13 74 29 2 178 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella sp. (strain ANA-3)
Q0HLQ7 2.34e-13 73 28 2 178 3 rlmG Ribosomal RNA large subunit methyltransferase G Shewanella sp. (strain MR-4)
Q58292 6.62e-13 70 28 6 173 1 MJ0882 Probable S-adenosylmethionine-dependent methyltransferase MJ0882 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q0EDR2 1.37e-12 71 26 7 287 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas savastanoi pv. phaseolicola
Q48DT7 1.37e-12 71 26 7 287 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3K6H7 3.12e-12 70 25 6 282 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas fluorescens (strain Pf0-1)
A4VI28 1.14e-11 68 24 4 265 3 rlmG Ribosomal RNA large subunit methyltransferase G Stutzerimonas stutzeri (strain A1501)
Q4ZNG3 1.16e-11 68 26 8 288 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas syringae pv. syringae (strain B728a)
B0KHQ8 1.54e-11 68 25 4 265 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas putida (strain GB-1)
A5W920 3e-11 67 26 7 268 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q87WA9 3.23e-11 67 24 9 353 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B1J2W7 3.74e-11 67 25 4 276 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas putida (strain W619)
P37872 3.83e-11 65 30 4 153 3 ybxB Uncharacterized protein YbxB Bacillus subtilis (strain 168)
Q02G60 4.07e-11 67 25 10 325 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas aeruginosa (strain UCBPP-PA14)
Q88E20 4.22e-11 67 25 7 268 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A6VC08 9.03e-11 65 25 10 325 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas aeruginosa (strain PA7)
Q9HVH4 1.93e-10 65 24 10 325 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4K5Q4 5.36e-10 63 23 9 353 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1I4K4 5.77e-10 63 24 6 278 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas entomophila (strain L48)
B4RZB4 1.1e-09 62 25 6 262 3 rlmG Ribosomal RNA large subunit methyltransferase G Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A4XQA3 1.28e-07 56 24 6 250 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas mendocina (strain ymp)
Q1II29 4.99e-06 50 38 3 77 3 prmC Release factor glutamine methyltransferase Koribacter versatilis (strain Ellin345)
Q9JTA1 1.51e-05 49 31 4 107 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q58338 1.52e-05 48 25 2 140 3 MJ0928 Putative protein N5-glutamine methyltransferase MJ0928 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A6LJG3 1.53e-05 49 30 5 135 3 prmA Ribosomal protein L11 methyltransferase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q9JYC0 1.55e-05 49 31 4 107 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8DPZ3 1.88e-05 49 27 2 125 3 prmC Release factor glutamine methyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q5F783 2.9e-05 48 31 4 106 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P75419 0.000115 47 29 2 108 4 MPN_362 Uncharacterized protein MG259 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q9CHX0 0.00012 46 24 1 93 3 prmC Release factor glutamine methyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
Q7W022 0.000145 46 36 3 76 3 prmC Release factor glutamine methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8KCD5 0.000725 44 25 2 142 3 prmC Release factor glutamine methyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8Y4A9 0.00079 44 30 1 78 3 prmC Release factor glutamine methyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS12335
Feature type CDS
Gene rsmC
Product 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC
Location 2733887 - 2734900 (strand: 1)
Length 1014 (nucleotides) / 337 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2351
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05175 Methyltransferase small domain
PF08468 Methyltransferase small domain N-terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2813 Translation, ribosomal structure and biogenesis (J) J 16S rRNA G1207 methylase RsmC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00564 16S rRNA (guanine1207-N2)-methyltransferase [EC:2.1.1.172] - -

Protein Sequence

MSSLSPASEVILRHLDHFADRHVLIAGDLQDTLASQIQAKSVRAYTNQYHQWLPLLKSMGDNAFFGLAADQSFVKYCDTLIYFWPKNKNEATFQLRSLCASLSVGTEIFIVGENRSGVKSATELMNGIAKLKKIDSARRCSLFFGSLTYQTLFDRNNWWQTYRYDDLTVMALPGVFSQTALDEGSRLLLSTFDDAMVGDLLDMACGCGVIATVLGKKNPMLKLTLCDVNAAAISSSIATLNVNELEGRVIASNVYSAVEETYDWIVSNPPFHDGLGTSYQAAEDIIRLAPNFLKKGGKLRIVANAFLPYQDILDHVFGSHEVLASTGKFKVYQATKK

Flanking regions ( +/- flanking 50bp)

TTTATATCTGATATCATGCGTTTTATGTTTTTTAAGGAGTAATAATCATAATGTCCTCATTGTCCCCTGCCAGCGAAGTTATTCTTCGTCATCTAGATCATTTCGCAGACAGGCACGTACTCATAGCAGGTGATCTTCAAGACACGCTAGCATCACAAATTCAGGCCAAAAGTGTTAGAGCCTATACAAATCAATATCACCAGTGGCTACCGCTACTCAAATCCATGGGTGATAATGCATTTTTTGGTTTAGCGGCAGATCAATCATTCGTAAAATATTGCGACACTTTGATTTATTTTTGGCCTAAGAATAAGAATGAAGCAACTTTTCAGTTACGTAGCTTATGCGCAAGTTTATCTGTCGGGACTGAAATCTTCATCGTCGGCGAAAACCGTAGTGGTGTAAAAAGTGCTACGGAATTAATGAATGGTATAGCAAAGCTAAAAAAAATAGATTCAGCACGTCGTTGTAGCCTCTTTTTTGGTTCACTAACCTATCAAACACTCTTTGATCGAAATAACTGGTGGCAAACTTATCGTTATGACGATTTAACGGTGATGGCATTACCCGGTGTTTTTAGTCAAACCGCATTAGATGAAGGCAGCCGATTATTACTCTCTACATTTGATGATGCAATGGTAGGTGACTTACTGGATATGGCCTGTGGTTGTGGGGTGATTGCCACGGTATTAGGCAAGAAAAACCCGATGTTAAAACTCACACTCTGTGACGTCAATGCAGCCGCTATTTCATCCAGTATTGCCACGTTAAATGTTAATGAATTAGAAGGACGGGTTATTGCAAGCAATGTCTATTCTGCGGTAGAAGAAACTTATGATTGGATAGTCTCTAATCCTCCTTTCCATGATGGCTTAGGTACCAGCTATCAAGCTGCAGAAGACATTATTCGTCTCGCGCCTAACTTTTTGAAAAAAGGCGGTAAACTGCGTATTGTTGCCAATGCTTTCTTACCTTATCAAGATATTCTTGATCACGTGTTTGGCTCTCATGAAGTGCTTGCATCAACAGGTAAATTCAAAGTTTACCAAGCAACCAAGAAATAGTAATCACCAGCACTATTATAAAAACCGCCAGTAATTGATTTTTCAACTAC