Homologs in group_4596

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4596

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4596

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS12310
Feature type CDS
Gene -
Product DNA-binding protein
Location 2729936 - 2730130 (strand: -1)
Length 195 (nucleotides) / 64 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4596
Orthogroup size 1
N. genomes 1

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3311 Transcription (K)
Mobilome: prophages, transposons (X)
KX DNA-binding transcriptional regulator AlpA

Protein Sequence

MTAVAHQITPFLTSYEVMARYHISYTTLWRRIKDGSLPQPRINRNTRNKLWHIEDLEEYEKKED

Flanking regions ( +/- flanking 50bp)

GTGATGAATCAGGCGATGATAGCTTTACATTGATTTTCAGGAGAATGCAGATGACAGCAGTAGCGCACCAGATAACCCCTTTTCTAACATCTTACGAAGTGATGGCTCGTTACCACATTAGCTATACGACGCTCTGGCGAAGAATAAAAGATGGCAGCTTGCCGCAACCTCGTATCAACCGAAATACACGAAACAAGCTGTGGCACATTGAAGACTTGGAGGAGTATGAGAAGAAAGAGGACTGAGCCTCTTTCTTTTATTTTACTGTCCGAAACGCCAGTTGAATGGAAAGCCT