Homologs in group_2313

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17510 FBDBKF_17510 89.4 Morganella morganii S1 plsY glycerol-3-phosphate 1-O-acyltransferase PlsY
EHELCC_17405 EHELCC_17405 89.4 Morganella morganii S2 plsY glycerol-3-phosphate 1-O-acyltransferase PlsY
NLDBIP_17790 NLDBIP_17790 89.4 Morganella morganii S4 plsY glycerol-3-phosphate 1-O-acyltransferase PlsY
LHKJJB_17710 LHKJJB_17710 89.4 Morganella morganii S3 plsY glycerol-3-phosphate 1-O-acyltransferase PlsY
HKOGLL_17720 HKOGLL_17720 89.4 Morganella morganii S5 plsY glycerol-3-phosphate 1-O-acyltransferase PlsY
F4V73_RS16685 F4V73_RS16685 86.7 Morganella psychrotolerans plsY glycerol-3-phosphate 1-O-acyltransferase PlsY

Distribution of the homologs in the orthogroup group_2313

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2313

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EW52 4.65e-160 444 100 0 218 3 plsY Glycerol-3-phosphate acyltransferase Proteus mirabilis (strain HI4320)
A1JQW7 2.41e-124 353 82 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JM19 2.2e-123 351 80 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665U6 2.2e-123 351 80 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4THT2 2.2e-123 351 80 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pestis (strain Pestoides F)
Q1CME1 2.2e-123 351 80 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZI67 2.2e-123 351 80 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pestis
B2K2I2 2.2e-123 351 80 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C367 2.2e-123 351 80 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FE72 2.2e-123 351 80 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7N0B7 2.87e-123 350 83 0 218 3 plsY Glycerol-3-phosphate acyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GJV0 9.46e-123 349 81 0 202 3 plsY Glycerol-3-phosphate acyltransferase Serratia proteamaculans (strain 568)
C6DDM0 4.68e-122 347 77 0 210 3 plsY Glycerol-3-phosphate acyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q2NWE5 1.01e-119 341 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Sodalis glossinidius (strain morsitans)
C5BHG2 2.4e-119 341 74 0 217 3 plsY Glycerol-3-phosphate acyltransferase Edwardsiella ictaluri (strain 93-146)
A9MPV6 6.39e-118 337 79 0 205 3 plsY Glycerol-3-phosphate acyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8APU2 2.21e-117 335 79 0 205 3 plsY Glycerol-3-phosphate acyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2VGJ1 2.28e-117 335 78 0 199 3 plsY Glycerol-3-phosphate acyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6D157 3.58e-117 335 74 0 210 3 plsY Glycerol-3-phosphate acyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B4TVU1 9.07e-117 333 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Salmonella schwarzengrund (strain CVM19633)
P67161 1.88e-116 333 79 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67162 1.88e-116 333 79 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella typhi
B5BG18 1.88e-116 333 79 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella paratyphi A (strain AKU_12601)
A9N5Y5 1.88e-116 333 79 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PC79 1.88e-116 333 79 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T677 1.88e-116 333 79 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella newport (strain SL254)
B4TI58 1.88e-116 333 79 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella heidelberg (strain SL476)
B5REG5 1.88e-116 333 79 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ43 1.88e-116 333 79 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella enteritidis PT4 (strain P125109)
B5FHU2 1.88e-116 333 79 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella dublin (strain CT_02021853)
Q57JQ2 1.88e-116 333 79 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella choleraesuis (strain SC-B67)
B5F6A3 1.88e-116 333 79 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella agona (strain SL483)
A7MJT5 5.01e-116 332 77 0 205 3 plsY Glycerol-3-phosphate acyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
B7LQD7 2.74e-115 330 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q3YXI3 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Shigella sonnei (strain Ss046)
Q32BQ6 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q31WX6 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Shigella boydii serotype 4 (strain Sb227)
B2U1G3 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R6S2 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain UTI89 / UPEC)
B1LF51 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B6I430 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain SE11)
B7ND48 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P60782 1.13e-114 328 78 1 206 1 plsY Probable glycerol-3-phosphate acyltransferase Escherichia coli (strain K12)
B1IRQ7 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P60783 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TD47 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AFY1 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O1:K1 / APEC
A8A4L4 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O9:H4 (strain HS)
B1XG64 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain K12 / DH10B)
C4ZQX6 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZK9 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O8 (strain IAI1)
B7N0K9 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O81 (strain ED1a)
B7NJS2 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YR99 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P60784 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O157:H7
B7LGZ5 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain 55989 / EAEC)
B7MAZ5 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIW7 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZRU0 1.13e-114 328 78 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
P59252 7.26e-114 326 77 1 206 3 plsY Glycerol-3-phosphate acyltransferase Shigella flexneri
Q0T0K4 7.26e-114 326 77 1 206 3 plsY Glycerol-3-phosphate acyltransferase Shigella flexneri serotype 5b (strain 8401)
B5XU32 1.32e-111 320 74 0 205 3 plsY Glycerol-3-phosphate acyltransferase Klebsiella pneumoniae (strain 342)
A6TE38 5.2e-111 319 74 0 205 3 plsY Glycerol-3-phosphate acyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WEJ1 5.6e-111 319 78 0 193 3 plsY Glycerol-3-phosphate acyltransferase Enterobacter sp. (strain 638)
P44603 2.64e-100 292 69 0 199 3 plsY Glycerol-3-phosphate acyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UG86 2.64e-100 292 69 0 199 3 plsY Glycerol-3-phosphate acyltransferase Haemophilus influenzae (strain PittGG)
Q4QNS2 2.64e-100 292 69 0 199 3 plsY Glycerol-3-phosphate acyltransferase Haemophilus influenzae (strain 86-028NP)
A5UAM4 4.09e-100 291 69 0 199 3 plsY Glycerol-3-phosphate acyltransferase Haemophilus influenzae (strain PittEE)
Q6LV09 1.03e-99 290 66 0 201 3 plsY Glycerol-3-phosphate acyltransferase Photobacterium profundum (strain SS9)
Q9CKC7 3.11e-99 289 67 0 201 3 plsY Glycerol-3-phosphate acyltransferase Pasteurella multocida (strain Pm70)
Q65RI0 2.84e-97 284 64 0 205 3 plsY Glycerol-3-phosphate acyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VQI5 3.7e-96 281 67 0 199 3 plsY Glycerol-3-phosphate acyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
C3LS13 1.44e-95 280 61 0 208 3 plsY Glycerol-3-phosphate acyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KUJ7 1.44e-95 280 61 0 208 3 plsY Glycerol-3-phosphate acyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F9D1 1.44e-95 280 61 0 208 3 plsY Glycerol-3-phosphate acyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7VIV7 3.05e-92 271 66 0 195 3 plsY Glycerol-3-phosphate acyltransferase Vibrio atlanticus (strain LGP32)
B5FB81 2.03e-91 269 63 0 195 3 plsY Glycerol-3-phosphate acyltransferase Aliivibrio fischeri (strain MJ11)
Q5E2K3 2.03e-91 269 63 0 195 3 plsY Glycerol-3-phosphate acyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7MNZ7 3.37e-91 269 64 0 195 3 plsY Glycerol-3-phosphate acyltransferase Vibrio vulnificus (strain YJ016)
P59257 1.76e-90 267 64 0 195 3 plsY Glycerol-3-phosphate acyltransferase Vibrio vulnificus (strain CMCP6)
B8F6X1 2.76e-90 266 62 1 204 3 plsY Glycerol-3-phosphate acyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
A7MWQ0 6.84e-90 265 62 1 204 3 plsY Glycerol-3-phosphate acyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q87SL3 8.99e-90 265 62 1 204 3 plsY Glycerol-3-phosphate acyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B6EM14 2.77e-88 261 63 0 193 3 plsY Glycerol-3-phosphate acyltransferase Aliivibrio salmonicida (strain LFI1238)
B0BQT0 3.59e-85 253 61 0 195 3 plsY Glycerol-3-phosphate acyltransferase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GYC1 3.59e-85 253 61 0 195 3 plsY Glycerol-3-phosphate acyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N1Y9 3.59e-85 253 61 0 195 3 plsY Glycerol-3-phosphate acyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VMJ8 3.17e-84 251 60 0 199 3 plsY Glycerol-3-phosphate acyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B1KHE3 5.58e-83 248 60 1 203 3 plsY Glycerol-3-phosphate acyltransferase Shewanella woodyi (strain ATCC 51908 / MS32)
A4SI95 1.2e-82 248 54 0 218 3 plsY Glycerol-3-phosphate acyltransferase Aeromonas salmonicida (strain A449)
Q0HG43 4e-82 246 60 0 193 3 plsY Glycerol-3-phosphate acyltransferase Shewanella sp. (strain MR-4)
A1RMH7 1.08e-81 245 60 0 193 3 plsY Glycerol-3-phosphate acyltransferase Shewanella sp. (strain W3-18-1)
A4Y4F4 1.08e-81 245 60 0 193 3 plsY Glycerol-3-phosphate acyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A3QBM4 1.52e-81 244 60 1 196 3 plsY Glycerol-3-phosphate acyltransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
P59251 1.57e-81 244 60 0 192 3 plsY Glycerol-3-phosphate acyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HSD6 2.77e-81 244 60 0 192 3 plsY Glycerol-3-phosphate acyltransferase Shewanella sp. (strain MR-7)
A0KZT7 8.35e-81 243 60 0 192 3 plsY Glycerol-3-phosphate acyltransferase Shewanella sp. (strain ANA-3)
Q47W34 1.41e-80 242 58 0 192 3 plsY Glycerol-3-phosphate acyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q0I4T6 4.28e-80 240 58 1 198 3 plsY Glycerol-3-phosphate acyltransferase Histophilus somni (strain 129Pt)
Q12KB8 1.03e-79 240 59 1 196 3 plsY Glycerol-3-phosphate acyltransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A8FS65 4.36e-79 238 59 0 192 3 plsY Glycerol-3-phosphate acyltransferase Shewanella sediminis (strain HAW-EB3)
Q15X19 1.15e-78 237 58 1 198 3 plsY Glycerol-3-phosphate acyltransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B0TIN9 1.42e-78 237 59 0 188 3 plsY Glycerol-3-phosphate acyltransferase Shewanella halifaxensis (strain HAW-EB4)
Q3IHX2 1.3e-75 229 56 0 197 3 plsY Glycerol-3-phosphate acyltransferase Pseudoalteromonas translucida (strain TAC 125)
Q5QY47 2.56e-75 228 57 0 189 3 plsY Glycerol-3-phosphate acyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9L5I4 5.17e-73 223 59 0 198 3 plsY Glycerol-3-phosphate acyltransferase Shewanella baltica (strain OS195)
A6WKK5 5.17e-73 223 59 0 198 3 plsY Glycerol-3-phosphate acyltransferase Shewanella baltica (strain OS185)
A3D1Q5 5.17e-73 223 59 0 198 3 plsY Glycerol-3-phosphate acyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBV4 5.17e-73 223 59 0 198 3 plsY Glycerol-3-phosphate acyltransferase Shewanella baltica (strain OS223)
Q493X7 1.84e-72 221 55 0 186 3 plsY Glycerol-3-phosphate acyltransferase Blochmanniella pennsylvanica (strain BPEN)
C4LB58 8.03e-69 212 56 1 203 3 plsY Glycerol-3-phosphate acyltransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q0BMC8 2.85e-57 183 47 1 197 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. holarctica (strain OSU18)
A0Q6X6 3.14e-57 182 47 1 197 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. novicida (strain U112)
Q2A3Z1 3.35e-57 182 47 1 197 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. holarctica (strain LVS)
A7NBL2 3.35e-57 182 47 1 197 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B2SDD0 7.83e-57 182 46 1 197 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. mediasiatica (strain FSC147)
B8GPT8 3.8e-56 180 51 4 198 3 plsY Glycerol-3-phosphate acyltransferase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
B0TYY2 6.98e-56 179 46 1 197 3 plsY Glycerol-3-phosphate acyltransferase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q5NFU6 7.13e-56 179 46 1 197 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14H98 7.13e-56 179 46 1 197 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. tularensis (strain FSC 198)
Q7VQQ8 1.84e-53 173 49 0 188 3 plsY Glycerol-3-phosphate acyltransferase Blochmanniella floridana
Q3JF14 2.23e-53 172 48 1 186 3 plsY Glycerol-3-phosphate acyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q5ZT09 1.5e-50 168 48 1 190 3 plsY Glycerol-3-phosphate acyltransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X2T2 2.24e-50 167 48 1 190 3 plsY Glycerol-3-phosphate acyltransferase Legionella pneumophila (strain Paris)
Q5WU90 5.38e-50 167 48 1 190 3 plsY Glycerol-3-phosphate acyltransferase Legionella pneumophila (strain Lens)
A5IEF8 5.55e-50 166 48 1 190 3 plsY Glycerol-3-phosphate acyltransferase Legionella pneumophila (strain Corby)
A1AXL0 8.42e-48 158 47 3 184 3 plsY Glycerol-3-phosphate acyltransferase Ruthia magnifica subsp. Calyptogena magnifica
Q602S2 7.51e-47 156 47 2 190 3 plsY Glycerol-3-phosphate acyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q31EM0 1.19e-45 153 41 2 198 3 plsY Glycerol-3-phosphate acyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q7VXN3 4.32e-45 152 47 4 205 3 plsY Glycerol-3-phosphate acyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W669 4.32e-45 152 47 4 205 3 plsY Glycerol-3-phosphate acyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WI35 4.32e-45 152 47 4 205 3 plsY Glycerol-3-phosphate acyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A1WZI0 2.96e-44 149 47 3 189 3 plsY Glycerol-3-phosphate acyltransferase Halorhodospira halophila (strain DSM 244 / SL1)
Q83C89 4.28e-44 149 43 1 185 3 plsY Glycerol-3-phosphate acyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NDU9 4.28e-44 149 43 1 185 3 plsY Glycerol-3-phosphate acyltransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KFT7 4.28e-44 149 43 1 185 3 plsY Glycerol-3-phosphate acyltransferase Coxiella burnetii (strain Dugway 5J108-111)
B6J7P8 4.28e-44 149 43 1 185 3 plsY Glycerol-3-phosphate acyltransferase Coxiella burnetii (strain CbuK_Q154)
B6IZN9 4.47e-44 149 43 1 185 3 plsY Glycerol-3-phosphate acyltransferase Coxiella burnetii (strain CbuG_Q212)
Q8XWC8 8.45e-44 149 47 4 194 3 plsY Glycerol-3-phosphate acyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q1IG30 1.64e-43 147 43 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas entomophila (strain L48)
B2UB97 1.9e-43 147 46 3 193 3 plsY Glycerol-3-phosphate acyltransferase Ralstonia pickettii (strain 12J)
Q0KE35 2.65e-43 147 46 3 194 3 plsY Glycerol-3-phosphate acyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B2JDU2 3.76e-43 147 42 2 203 3 plsY Glycerol-3-phosphate acyltransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q2Y7B5 3.91e-43 147 49 6 196 3 plsY Glycerol-3-phosphate acyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B3R0V4 1.72e-42 145 45 2 192 3 plsY Glycerol-3-phosphate acyltransferase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q1LR23 2.21e-42 145 44 3 196 3 plsY Glycerol-3-phosphate acyltransferase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q475H6 3.34e-42 144 45 4 194 3 plsY Glycerol-3-phosphate acyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q21UZ2 6.56e-42 144 39 3 208 3 plsY Glycerol-3-phosphate acyltransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q1GYU3 2.66e-41 142 49 1 185 3 plsY Glycerol-3-phosphate acyltransferase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q4ZMF5 3.78e-41 141 42 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas syringae pv. syringae (strain B728a)
A9IP09 5.74e-41 141 45 2 199 3 plsY Glycerol-3-phosphate acyltransferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q13UQ8 7.96e-41 141 44 4 202 3 plsY Glycerol-3-phosphate acyltransferase Paraburkholderia xenovorans (strain LB400)
Q2S8V8 1.65e-40 140 42 0 182 3 plsY Glycerol-3-phosphate acyltransferase Hahella chejuensis (strain KCTC 2396)
A9AGJ3 2.17e-40 140 44 2 201 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia multivorans (strain ATCC 17616 / 249)
Q6FZS3 3.94e-40 139 39 3 202 3 plsY Glycerol-3-phosphate acyltransferase Bartonella quintana (strain Toulouse)
B2SY66 7.85e-40 139 46 3 189 3 plsY Glycerol-3-phosphate acyltransferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q6G3F5 1.57e-39 137 39 3 195 3 plsY Glycerol-3-phosphate acyltransferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q39DI4 2.41e-39 137 45 1 201 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2L004 4.08e-39 137 44 2 197 3 plsY Glycerol-3-phosphate acyltransferase Bordetella avium (strain 197N)
A6X570 5.15e-39 136 40 3 196 3 plsY Glycerol-3-phosphate acyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q0BCG3 1.14e-38 135 44 1 201 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YVE9 2.04e-38 135 44 1 201 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia ambifaria (strain MC40-6)
Q89K17 2.12e-38 134 40 2 188 3 plsY Glycerol-3-phosphate acyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A4G2A5 2.17e-38 134 47 6 196 3 plsY Glycerol-3-phosphate acyltransferase Herminiimonas arsenicoxydans
A1UT26 2.71e-38 134 38 4 199 3 plsY Glycerol-3-phosphate acyltransferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B1JXG6 4.01e-38 134 47 2 197 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia orbicola (strain MC0-3)
Q7NRU2 4.27e-38 134 42 4 203 3 plsY Glycerol-3-phosphate acyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1BU57 4.7e-38 134 45 2 202 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia orbicola (strain AU 1054)
A0K9X9 4.7e-38 134 45 2 202 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia cenocepacia (strain HI2424)
Q88QU5 6.02e-38 133 42 0 169 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q47IP1 6.32e-38 133 43 2 197 3 plsY Glycerol-3-phosphate acyltransferase Dechloromonas aromatica (strain RCB)
Q215Y7 1.04e-37 132 41 2 188 3 plsY Glycerol-3-phosphate acyltransferase Rhodopseudomonas palustris (strain BisB18)
A4JH88 1.61e-37 132 46 2 192 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q3SGB5 1.69e-37 132 43 3 188 3 plsY Glycerol-3-phosphate acyltransferase Thiobacillus denitrificans (strain ATCC 25259)
Q2T0L4 1.73e-37 132 43 3 198 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q3JVC1 1.88e-37 132 44 2 191 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia pseudomallei (strain 1710b)
A5VXI5 2.17e-37 131 42 0 169 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q63WM5 2.62e-37 132 44 2 191 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia pseudomallei (strain K96243)
A6SV70 3.46e-37 131 47 7 196 3 plsY Glycerol-3-phosphate acyltransferase Janthinobacterium sp. (strain Marseille)
Q3K5S2 7.36e-37 130 40 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q62M79 8.48e-37 130 43 2 191 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia mallei (strain ATCC 23344)
Q4K4W5 1.86e-36 129 42 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q2W158 1.96e-36 129 42 3 194 3 plsY Glycerol-3-phosphate acyltransferase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q88A56 2.28e-36 129 44 0 179 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B0KJ83 3.37e-36 128 40 0 169 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas putida (strain GB-1)
A9IU40 4.03e-36 129 38 2 196 3 plsY Glycerol-3-phosphate acyltransferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q2NB90 5.11e-36 128 38 3 189 3 plsY Glycerol-3-phosphate acyltransferase Erythrobacter litoralis (strain HTCC2594)
B4E9G9 9.79e-36 128 46 2 202 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A6UZ84 1.23e-35 127 42 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas aeruginosa (strain PA7)
Q48NU7 1.43e-35 127 43 0 179 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q9I5V6 2.94e-35 126 42 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TI2 2.94e-35 126 42 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V4G7 2.94e-35 126 42 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas aeruginosa (strain LESB58)
A5IMD8 1.42e-34 124 38 1 184 3 plsY Glycerol-3-phosphate acyltransferase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
P59246 2.81e-34 124 38 2 195 3 plsY Glycerol-3-phosphate acyltransferase Brucella suis biovar 1 (strain 1330)
A9MBP1 2.81e-34 124 38 2 195 3 plsY Glycerol-3-phosphate acyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A9WYS0 3.34e-34 124 39 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
A8LL79 3.56e-34 124 46 4 186 3 plsY Glycerol-3-phosphate acyltransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A5VUT3 3.88e-34 124 39 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
C3K337 4.21e-34 123 41 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas fluorescens (strain SBW25)
Q8YC64 4.36e-34 123 39 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RLC2 4.36e-34 123 39 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
Q0AJ92 9.02e-34 122 47 3 191 3 plsY Glycerol-3-phosphate acyltransferase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
C4XH52 1.16e-33 122 37 5 201 3 plsY Glycerol-3-phosphate acyltransferase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q3SR23 2.09e-33 121 40 2 196 3 plsY Glycerol-3-phosphate acyltransferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q9JUL4 2.73e-33 121 43 3 196 3 plsY Glycerol-3-phosphate acyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q1IPR1 2.84e-33 122 41 5 199 3 plsY Glycerol-3-phosphate acyltransferase Koribacter versatilis (strain Ellin345)
Q135I3 4.06e-33 120 40 2 188 3 plsY Glycerol-3-phosphate acyltransferase Rhodopseudomonas palustris (strain BisB5)
A6U809 4.21e-33 121 40 3 194 3 plsY Glycerol-3-phosphate acyltransferase Sinorhizobium medicae (strain WSM419)
A9LYY1 4.93e-33 120 43 3 193 3 plsY Glycerol-3-phosphate acyltransferase Neisseria meningitidis serogroup C (strain 053442)
Q578A0 5.88e-33 120 38 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella abortus biovar 1 (strain 9-941)
Q2YKM0 5.88e-33 120 38 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella abortus (strain 2308)
B2SB55 5.88e-33 120 38 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella abortus (strain S19)
A1KTU8 6.44e-33 120 41 3 196 3 plsY Glycerol-3-phosphate acyltransferase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q8R9J2 1e-32 120 39 5 194 3 plsY Glycerol-3-phosphate acyltransferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B0K8N4 1.71e-32 119 40 5 195 3 plsY Glycerol-3-phosphate acyltransferase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q0AXC2 2.59e-32 119 38 2 190 3 plsY Glycerol-3-phosphate acyltransferase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B9M1A8 2.75e-32 119 41 5 187 3 plsY Glycerol-3-phosphate acyltransferase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q9JZG9 2.78e-32 119 42 3 193 3 plsY Glycerol-3-phosphate acyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A4WP17 2.91e-32 119 39 4 200 3 plsY Glycerol-3-phosphate acyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B0K3E3 3.96e-32 118 40 5 195 3 plsY Glycerol-3-phosphate acyltransferase Thermoanaerobacter sp. (strain X514)
O66905 4.81e-32 118 41 4 192 1 plsY Glycerol-3-phosphate acyltransferase Aquifex aeolicus (strain VF5)
B1JDY4 5.62e-32 117 40 0 169 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas putida (strain W619)
P59250 6.19e-32 117 39 2 182 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B1GZE4 6.45e-32 118 40 4 196 3 plsY Glycerol-3-phosphate acyltransferase Endomicrobium trichonymphae
C1DCY1 6.87e-32 118 43 3 197 3 plsY Glycerol-3-phosphate acyltransferase Laribacter hongkongensis (strain HLHK9)
Q834K7 1.74e-31 117 37 4 204 3 plsY Glycerol-3-phosphate acyltransferase Enterococcus faecalis (strain ATCC 700802 / V583)
B4RLD8 1.94e-31 117 43 3 196 3 plsY Glycerol-3-phosphate acyltransferase Neisseria gonorrhoeae (strain NCCP11945)
Q5F8C7 1.94e-31 117 43 3 196 3 plsY Glycerol-3-phosphate acyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1QL21 2.38e-31 116 40 3 198 3 plsY Glycerol-3-phosphate acyltransferase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A8G6D8 2.75e-31 116 38 2 190 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain MIT 9215)
Q2IXD3 2.78e-31 116 39 2 188 3 plsY Glycerol-3-phosphate acyltransferase Rhodopseudomonas palustris (strain HaA2)
A4YWG6 2.85e-31 116 40 2 188 3 plsY Glycerol-3-phosphate acyltransferase Bradyrhizobium sp. (strain ORS 278)
B9KNF0 3.18e-31 116 41 3 189 3 plsY Glycerol-3-phosphate acyltransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IZ47 3.18e-31 116 41 3 189 3 plsY Glycerol-3-phosphate acyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PN50 3.18e-31 116 41 3 189 3 plsY Glycerol-3-phosphate acyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q9X1F9 3.32e-31 116 37 1 184 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
C1DIY2 5.48e-31 115 40 0 182 3 plsY Glycerol-3-phosphate acyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A3PEG1 6.14e-31 115 38 2 190 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain MIT 9301)
Q5NN91 6.7e-31 115 41 5 208 3 plsY Glycerol-3-phosphate acyltransferase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A2BSP9 7.14e-31 115 37 2 190 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain AS9601)
Q98M84 1.01e-30 114 40 2 188 3 plsY Glycerol-3-phosphate acyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1MRX2 1.21e-30 114 39 7 190 3 plsY Glycerol-3-phosphate acyltransferase Lawsonia intracellularis (strain PHE/MN1-00)
A7Z575 1.22e-30 114 37 3 188 3 plsY Glycerol-3-phosphate acyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q92QL7 2.51e-30 114 38 2 193 3 plsY Glycerol-3-phosphate acyltransferase Rhizobium meliloti (strain 1021)
P60926 2.6e-30 113 38 4 191 3 plsY Glycerol-3-phosphate acyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q3A6U7 2.74e-30 113 42 5 191 3 plsY Glycerol-3-phosphate acyltransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A6TS38 4.01e-30 113 38 4 190 3 plsY Glycerol-3-phosphate acyltransferase Alkaliphilus metalliredigens (strain QYMF)
Q319G0 4.41e-30 113 36 2 190 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain MIT 9312)
Q46JD9 5.37e-30 113 36 2 191 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain NATL2A)
A5EKR0 5.61e-30 113 39 2 188 3 plsY Glycerol-3-phosphate acyltransferase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B8GZK4 9.6e-30 112 40 3 190 3 plsY Glycerol-3-phosphate acyltransferase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5K1 9.6e-30 112 40 3 190 3 plsY Glycerol-3-phosphate acyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2GI73 9.66e-30 112 34 2 186 3 plsY Glycerol-3-phosphate acyltransferase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q317C3 1.2e-29 112 37 4 196 3 plsY Glycerol-3-phosphate acyltransferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q5WGU3 1.61e-29 112 38 4 204 3 plsY Glycerol-3-phosphate acyltransferase Shouchella clausii (strain KSM-K16)
B9DP57 3.09e-29 111 34 3 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus carnosus (strain TM300)
A6LL73 3.76e-29 110 38 4 184 3 plsY Glycerol-3-phosphate acyltransferase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q182W4 3.78e-29 110 34 3 194 3 plsY Glycerol-3-phosphate acyltransferase Clostridioides difficile (strain 630)
Q5P260 3.79e-29 110 43 4 181 3 plsY Glycerol-3-phosphate acyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q39R89 4.12e-29 110 41 4 178 3 plsY Glycerol-3-phosphate acyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q82XN3 4.32e-29 110 43 2 191 3 plsY Glycerol-3-phosphate acyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A2C4A0 4.47e-29 110 36 2 191 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain NATL1A)
Q4FLQ2 5.38e-29 110 36 2 180 3 plsY Glycerol-3-phosphate acyltransferase Pelagibacter ubique (strain HTCC1062)
Q8RFY9 8.09e-29 109 35 2 187 3 plsY Glycerol-3-phosphate acyltransferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B3Q9X6 1.26e-28 109 38 2 193 3 plsY Glycerol-3-phosphate acyltransferase Rhodopseudomonas palustris (strain TIE-1)
P60929 1.26e-28 109 38 2 193 3 plsY Glycerol-3-phosphate acyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q73GB4 2.08e-28 108 35 2 188 3 plsY Glycerol-3-phosphate acyltransferase Wolbachia pipientis wMel
Q7NMV2 2.68e-28 108 36 2 194 3 plsY Glycerol-3-phosphate acyltransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B8J229 4.28e-28 108 37 4 185 3 plsY Glycerol-3-phosphate acyltransferase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B1YEC6 4.94e-28 108 38 6 200 3 plsY Glycerol-3-phosphate acyltransferase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q2RIV5 7.4e-28 107 38 3 194 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8UFU1 8.67e-28 107 43 2 184 3 plsY Glycerol-3-phosphate acyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
B3E8I3 1.51e-27 106 39 4 183 3 plsY Glycerol-3-phosphate acyltransferase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A7HIH5 2e-27 106 36 6 201 3 plsY Glycerol-3-phosphate acyltransferase Anaeromyxobacter sp. (strain Fw109-5)
C6BRS7 3.04e-27 105 35 4 191 3 plsY Glycerol-3-phosphate acyltransferase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q5GSL3 4.95e-27 105 34 2 185 3 plsY Glycerol-3-phosphate acyltransferase Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q9KCD3 5.86e-27 105 36 5 205 3 plsY Glycerol-3-phosphate acyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A2BY34 7.45e-27 105 35 1 189 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain MIT 9515)
Q65J17 8.35e-27 104 36 3 188 3 plsY Glycerol-3-phosphate acyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q45064 9.46e-27 104 33 3 188 1 plsY Glycerol-3-phosphate acyltransferase Bacillus subtilis (strain 168)
Q1MIH8 1.26e-26 104 38 3 197 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1DCA9 1.37e-26 103 39 3 188 3 plsY Glycerol-3-phosphate acyltransferase Myxococcus xanthus (strain DK1622)
Q1IXF1 1.41e-26 104 38 3 189 3 plsY Glycerol-3-phosphate acyltransferase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q49XE7 1.73e-26 103 36 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A4J3P2 2.09e-26 103 38 1 190 3 plsY Glycerol-3-phosphate acyltransferase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A8F7S3 2.86e-26 103 35 2 191 3 plsY Glycerol-3-phosphate acyltransferase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
B9JVI2 2.98e-26 103 38 4 196 3 plsY Glycerol-3-phosphate acyltransferase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q7V0D9 3.11e-26 103 35 1 189 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q2IH98 3.45e-26 103 36 7 203 3 plsY Glycerol-3-phosphate acyltransferase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q3YT97 3.56e-26 102 36 2 186 3 plsY Glycerol-3-phosphate acyltransferase Ehrlichia canis (strain Jake)
Q8YZG8 3.69e-26 103 33 3 215 3 plsY Glycerol-3-phosphate acyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q88W28 7.73e-26 102 32 6 208 3 plsY Glycerol-3-phosphate acyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9ZAF3 7.87e-26 102 37 3 194 3 plsY Glycerol-3-phosphate acyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q3K0U5 8.13e-26 102 34 4 209 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q1QYX9 9.8e-26 102 37 0 182 3 plsY Glycerol-3-phosphate acyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q3Z6P4 9.84e-26 102 36 6 212 3 plsY3 Glycerol-3-phosphate acyltransferase 3 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q92C68 1.21e-25 101 36 3 196 3 plsY Glycerol-3-phosphate acyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5SJ11 1.27e-25 101 37 3 194 3 plsY Glycerol-3-phosphate acyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q8KG75 1.3e-25 102 32 5 222 3 plsY Glycerol-3-phosphate acyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q6HFJ3 1.5e-25 101 33 3 195 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q28KD9 1.66e-25 101 42 2 178 3 plsY Glycerol-3-phosphate acyltransferase Jannaschia sp. (strain CCS1)
Q8Y7J3 1.67e-25 101 36 3 196 3 plsY Glycerol-3-phosphate acyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q0ANY0 1.94e-25 101 36 4 194 3 plsY Glycerol-3-phosphate acyltransferase Maricaulis maris (strain MCS10)
P60928 1.97e-25 101 33 2 216 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q81Y92 2.56e-25 100 33 3 195 3 plsY3 Glycerol-3-phosphate acyltransferase 3 Bacillus anthracis
A7GQU4 3.06e-25 100 33 3 195 3 plsY Glycerol-3-phosphate acyltransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q1WTS7 3.19e-25 100 31 3 207 3 plsY Glycerol-3-phosphate acyltransferase Ligilactobacillus salivarius (strain UCC118)
B8DG47 3.33e-25 100 36 3 196 3 plsY Glycerol-3-phosphate acyltransferase Listeria monocytogenes serotype 4a (strain HCC23)
Q720D7 3.33e-25 100 36 3 196 3 plsY Glycerol-3-phosphate acyltransferase Listeria monocytogenes serotype 4b (strain F2365)
C1L2J2 3.33e-25 100 36 3 196 3 plsY Glycerol-3-phosphate acyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q726E5 3.55e-25 103 36 4 199 3 plsY Glycerol-3-phosphate acyltransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q3M918 4.09e-25 101 33 3 215 3 plsY Glycerol-3-phosphate acyltransferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q4L661 4.21e-25 100 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus haemolyticus (strain JCSC1435)
B7IRQ1 5.32e-25 100 33 3 195 3 plsY Glycerol-3-phosphate acyltransferase Bacillus cereus (strain G9842)
Q812Z6 5.32e-25 100 33 3 195 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2K9P7 5.61e-25 100 37 3 197 3 plsY Glycerol-3-phosphate acyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B9EBV6 6.58e-25 99 34 4 184 3 plsY Glycerol-3-phosphate acyltransferase Macrococcus caseolyticus (strain JCSC5402)
A8Z223 6.87e-25 100 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
A6QGQ6 6.87e-25 100 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain Newman)
Q5HG66 6.87e-25 100 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain COL)
Q2FYS6 6.87e-25 100 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH82 6.87e-25 100 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain USA300)
Q3ZYV4 7.86e-25 100 36 6 214 3 plsY3 Glycerol-3-phosphate acyltransferase 3 Dehalococcoides mccartyi (strain CBDB1)
Q1AU71 8.7e-25 99 39 2 177 3 plsY Glycerol-3-phosphate acyltransferase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
B3CMU6 8.88e-25 99 32 2 185 3 plsY Glycerol-3-phosphate acyltransferase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q3AAU7 9.3e-25 99 35 2 185 3 plsY Glycerol-3-phosphate acyltransferase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P67165 1.03e-24 99 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain MW2)
Q6G9K6 1.03e-24 99 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain MSSA476)
Q6GH52 1.03e-24 99 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain MRSA252)
P67164 1.03e-24 99 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain N315)
P67163 1.03e-24 99 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISN6 1.03e-24 99 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain JH9)
A6U1H4 1.03e-24 99 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain JH1)
A7X211 1.03e-24 99 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B7JUX4 1.12e-24 99 34 4 207 3 plsY Glycerol-3-phosphate acyltransferase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q637M1 1.43e-24 99 33 3 195 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Bacillus cereus (strain ZK / E33L)
B3QLQ4 1.54e-24 99 31 5 222 3 plsY Glycerol-3-phosphate acyltransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B4U9R1 1.55e-24 99 35 5 193 3 plsY Glycerol-3-phosphate acyltransferase Hydrogenobaculum sp. (strain Y04AAS1)
Q2YXW4 1.68e-24 99 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q03S76 2.38e-24 98 32 4 207 3 plsY Glycerol-3-phosphate acyltransferase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q3B181 2.4e-24 99 31 4 225 3 plsY Glycerol-3-phosphate acyltransferase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q733N4 2.54e-24 98 33 3 195 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7KWA0 2.82e-24 98 38 2 188 3 plsY Glycerol-3-phosphate acyltransferase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
P67167 3.19e-24 98 34 4 205 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P67166 3.19e-24 98 34 4 205 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus agalactiae serotype III (strain NEM316)
A9W739 3.91e-24 97 38 2 188 3 plsY Glycerol-3-phosphate acyltransferase Methylorubrum extorquens (strain PA1)
B3PW35 4.43e-24 97 37 3 197 3 plsY Glycerol-3-phosphate acyltransferase Rhizobium etli (strain CIAT 652)
Q2GLU7 4.62e-24 97 36 5 187 3 plsY Glycerol-3-phosphate acyltransferase Anaplasma phagocytophilum (strain HZ)
B3EPU8 5.23e-24 98 31 5 219 3 plsY Glycerol-3-phosphate acyltransferase Chlorobium phaeobacteroides (strain BS1)
A1BJJ2 6.19e-24 98 31 5 219 3 plsY Glycerol-3-phosphate acyltransferase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q5KZ35 8.22e-24 97 34 3 181 3 plsY Glycerol-3-phosphate acyltransferase Geobacillus kaustophilus (strain HTA426)
B8JBQ8 9.42e-24 97 38 9 205 3 plsY Glycerol-3-phosphate acyltransferase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q38X02 1.05e-23 97 34 5 202 3 plsY Glycerol-3-phosphate acyltransferase Latilactobacillus sakei subsp. sakei (strain 23K)
Q98QR6 1.36e-23 97 34 8 212 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasmopsis pulmonis (strain UAB CTIP)
B1ZLL2 1.43e-23 96 38 2 188 3 plsY Glycerol-3-phosphate acyltransferase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q5FK09 2.14e-23 96 30 3 203 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
C5DAS3 2.67e-23 95 32 3 189 3 plsY Glycerol-3-phosphate acyltransferase Geobacillus sp. (strain WCH70)
P59253 2.84e-23 95 32 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
B0S1N1 2.94e-23 95 34 6 200 3 plsY Glycerol-3-phosphate acyltransferase Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
C5CIV2 5.87e-23 95 37 5 186 3 plsY Glycerol-3-phosphate acyltransferase Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
Q6AQV6 5.9e-23 94 35 6 197 3 plsY Glycerol-3-phosphate acyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q163C2 5.93e-23 94 36 2 187 3 plsY Glycerol-3-phosphate acyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q5FF11 6.81e-23 94 35 2 190 3 plsY Glycerol-3-phosphate acyltransferase Ehrlichia ruminantium (strain Gardel)
Q5HPI7 7.36e-23 94 32 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
C3MA95 7.69e-23 94 41 4 189 3 plsY Glycerol-3-phosphate acyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B1I461 1.2e-22 94 36 4 197 3 plsY Glycerol-3-phosphate acyltransferase Desulforudis audaxviator (strain MP104C)
P75428 1.49e-22 94 32 9 224 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P59256 1.66e-22 94 32 4 204 3 plsY Glycerol-3-phosphate acyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
C0ME59 2.31e-22 93 30 4 213 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus equi subsp. zooepidemicus (strain H70)
Q5HCG2 2.48e-22 93 35 3 192 3 plsY Glycerol-3-phosphate acyltransferase Ehrlichia ruminantium (strain Welgevonden)
B4UIV7 2.84e-22 93 35 7 203 3 plsY Glycerol-3-phosphate acyltransferase Anaeromyxobacter sp. (strain K)
A7ZBZ7 3.2e-22 92 34 8 198 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter concisus (strain 13826)
Q2RPF8 3.27e-22 93 41 4 206 3 plsY Glycerol-3-phosphate acyltransferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q5LX62 3.87e-22 92 35 2 187 3 plsY Glycerol-3-phosphate acyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q81N43 4.48e-22 92 34 4 189 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Bacillus anthracis
C0M7J7 6.83e-22 92 31 4 198 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus equi subsp. equi (strain 4047)
B3EI29 7.08e-22 92 29 4 226 3 plsY Glycerol-3-phosphate acyltransferase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
C1CS41 8e-22 92 34 5 198 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain Taiwan19F-14)
B4U3D2 8.09e-22 92 31 3 198 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
A3CN81 8.71e-22 92 35 6 204 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus sanguinis (strain SK36)
Q7VAP9 1.22e-21 91 36 2 197 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q3AZD7 1.24e-21 91 36 1 169 3 plsY Glycerol-3-phosphate acyltransferase Synechococcus sp. (strain CC9902)
Q97G69 1.39e-21 91 34 6 192 3 plsY Glycerol-3-phosphate acyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q3AP02 1.98e-21 91 27 4 226 3 plsY Glycerol-3-phosphate acyltransferase Chlorobium chlorochromatii (strain CaD3)
B2G735 2.19e-21 90 35 6 210 3 plsY Glycerol-3-phosphate acyltransferase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJM1 2.19e-21 90 35 6 210 3 plsY Glycerol-3-phosphate acyltransferase Limosilactobacillus reuteri (strain DSM 20016)
A0AI87 2.68e-21 90 34 2 195 3 plsY Glycerol-3-phosphate acyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q0C099 3.03e-21 90 38 4 197 3 plsY Glycerol-3-phosphate acyltransferase Hyphomonas neptunium (strain ATCC 15444)
Q9RSV1 3.34e-21 90 39 6 192 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
B4S675 4.37e-21 90 30 5 219 3 plsY Glycerol-3-phosphate acyltransferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q7NB93 5.16e-21 90 31 8 227 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q24VA3 6.14e-21 89 36 5 188 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Desulfitobacterium hafniense (strain Y51)
B5XL22 6.55e-21 89 32 4 201 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M49 (strain NZ131)
P0DD11 6.55e-21 89 32 4 201 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48U03 6.55e-21 89 32 4 201 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2REZ8 6.55e-21 89 32 4 201 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J722 6.55e-21 89 32 4 201 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JHA3 6.55e-21 89 32 4 201 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JM58 6.55e-21 89 32 4 201 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JC74 6.55e-21 89 32 4 201 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M12 (strain MGAS2096)
P67170 6.55e-21 89 32 4 201 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCK1 6.55e-21 89 32 4 201 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DD10 6.55e-21 89 32 4 201 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P67168 6.55e-21 89 32 4 201 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M1
Q30ST6 6.67e-21 89 34 6 202 3 plsY Glycerol-3-phosphate acyltransferase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q7U8N7 1.11e-20 89 35 1 181 3 plsY Glycerol-3-phosphate acyltransferase Parasynechococcus marenigrum (strain WH8102)
A4SGV1 1.41e-20 89 28 4 228 3 plsY Glycerol-3-phosphate acyltransferase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A9BBV0 1.52e-20 88 35 2 197 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain MIT 9211)
Q2NJF6 2.09e-20 89 29 6 218 3 plsY Glycerol-3-phosphate acyltransferase Aster yellows witches'-broom phytoplasma (strain AYWB)
Q8L3A1 2.46e-20 88 29 7 221 3 plsY Glycerol-3-phosphate acyltransferase Acholeplasma laidlawii
Q24Y16 3.98e-20 87 33 2 186 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Desulfitobacterium hafniense (strain Y51)
B1V9H9 5.22e-20 87 29 4 212 3 plsY Glycerol-3-phosphate acyltransferase Phytoplasma australiense
B1IB20 7.15e-20 87 33 5 198 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain Hungary19A-6)
A6Q218 9.51e-20 86 35 5 199 3 plsY Glycerol-3-phosphate acyltransferase Nitratiruptor sp. (strain SB155-2)
C1CJU2 9.59e-20 86 33 5 198 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain P1031)
C1CDJ9 9.59e-20 86 33 5 198 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain JJA)
P0A4Q0 9.59e-20 86 33 5 198 1 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4P9 9.59e-20 86 33 5 198 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZNQ1 9.59e-20 86 33 5 198 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1C6I5 9.59e-20 86 33 5 198 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain 70585)
B5E3M4 9.59e-20 86 33 5 198 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae serotype 19F (strain G54)
Q04L63 9.59e-20 86 33 5 198 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q3AHU3 9.61e-20 86 35 1 183 3 plsY Glycerol-3-phosphate acyltransferase Synechococcus sp. (strain CC9605)
Q4A729 9.89e-20 87 29 10 225 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasmopsis synoviae (strain 53)
Q67NS8 1.15e-19 86 32 6 202 3 plsY Glycerol-3-phosphate acyltransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B2INX0 3.29e-19 85 33 5 198 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain CGSP14)
Q9X972 3.77e-19 85 33 3 202 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q7V5Y3 4.98e-19 84 35 2 189 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain MIT 9313)
Q2JPG8 5.53e-19 84 34 2 198 3 plsY Glycerol-3-phosphate acyltransferase Synechococcus sp. (strain JA-2-3B'a(2-13))
B4SGX7 9.15e-19 84 27 4 226 3 plsY Glycerol-3-phosphate acyltransferase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q1GMR9 1.08e-18 83 39 2 185 3 plsY Glycerol-3-phosphate acyltransferase Ruegeria sp. (strain TM1040)
P47489 1.1e-18 84 32 10 220 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P59255 1.35e-18 83 31 5 210 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B1X0W5 2.41e-18 83 32 3 181 3 plsY Glycerol-3-phosphate acyltransferase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q10ZX6 2.89e-18 83 30 3 219 3 plsY Glycerol-3-phosphate acyltransferase Trichodesmium erythraeum (strain IMS101)
Q5FRH0 2.93e-18 82 40 4 190 3 plsY Glycerol-3-phosphate acyltransferase Gluconobacter oxydans (strain 621H)
Q81DG8 3e-18 82 36 1 140 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2S2H7 4.89e-18 82 31 3 208 3 plsY Glycerol-3-phosphate acyltransferase Salinibacter ruber (strain DSM 13855 / M31)
P73933 9.37e-18 81 33 8 213 3 plsY Glycerol-3-phosphate acyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5N0E4 1.08e-17 81 35 4 211 3 plsY Glycerol-3-phosphate acyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31LI2 1.08e-17 81 35 4 211 3 plsY Glycerol-3-phosphate acyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5M5A4 2.41e-17 80 30 7 207 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M0R8 2.41e-17 80 30 7 207 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus thermophilus (strain CNRZ 1066)
Q81QF8 3.13e-17 79 32 2 170 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Bacillus anthracis
Q3ZW79 4.38e-17 80 41 0 113 3 plsY4 Glycerol-3-phosphate acyltransferase 4 Dehalococcoides mccartyi (strain CBDB1)
B9KEQ5 5.68e-17 79 30 5 202 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q9PQ85 7.93e-17 79 28 6 237 3 plsY Glycerol-3-phosphate acyltransferase Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AJ44 7.93e-17 79 28 6 237 3 plsY Glycerol-3-phosphate acyltransferase Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Q03LM3 8.53e-17 79 30 7 207 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5P9D8 9.91e-17 78 32 4 189 3 plsY Glycerol-3-phosphate acyltransferase Anaplasma marginale (strain St. Maries)
Q63BB0 1.07e-16 77 32 2 170 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Bacillus cereus (strain ZK / E33L)
Q0BTZ8 1.11e-16 78 33 4 198 3 plsY Glycerol-3-phosphate acyltransferase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B9KH94 1.17e-16 78 32 4 189 3 plsY Glycerol-3-phosphate acyltransferase Anaplasma marginale (strain Florida)
A8EWC8 1.8e-16 77 32 5 201 3 plsY Glycerol-3-phosphate acyltransferase Aliarcobacter butzleri (strain RM4018)
Q039D7 2.08e-16 77 31 3 188 3 plsY Glycerol-3-phosphate acyltransferase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WEB1 2.08e-16 77 31 3 188 3 plsY Glycerol-3-phosphate acyltransferase Lacticaseibacillus casei (strain BL23)
A5UZW0 2.5e-16 77 33 4 195 3 plsY Glycerol-3-phosphate acyltransferase Roseiflexus sp. (strain RS-1)
A5IYF1 2.69e-16 78 30 4 216 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
Q6HIP2 4.58e-16 76 31 2 170 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q2G7D3 5.17e-16 76 39 3 189 3 plsY Glycerol-3-phosphate acyltransferase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
P60823 7.01e-16 75 35 4 157 3 plsY Glycerol-3-phosphate acyltransferase Onion yellows phytoplasma (strain OY-M)
Q2JV01 1.07e-15 75 36 2 170 3 plsY Glycerol-3-phosphate acyltransferase Synechococcus sp. (strain JA-3-3Ab)
B5ZBQ1 1.26e-15 76 29 6 225 3 plsY Glycerol-3-phosphate acyltransferase Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
Q1CRF2 1.58e-15 75 31 5 204 3 plsY Glycerol-3-phosphate acyltransferase Helicobacter pylori (strain HPAG1)
A7H515 1.58e-15 75 30 5 200 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B0CCQ8 2.46e-15 75 31 2 215 3 plsY Glycerol-3-phosphate acyltransferase Acaryochloris marina (strain MBIC 11017)
Q9ZJB1 3.05e-15 74 32 6 204 3 plsY Glycerol-3-phosphate acyltransferase Helicobacter pylori (strain J99 / ATCC 700824)
O26039 3.67e-15 74 32 6 204 3 plsY Glycerol-3-phosphate acyltransferase Helicobacter pylori (strain ATCC 700392 / 26695)
Q17ZJ0 8.26e-15 73 31 6 205 3 plsY Glycerol-3-phosphate acyltransferase Helicobacter acinonychis (strain Sheeba)
Q737Z5 1.04e-14 72 32 2 170 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6KIH2 1.1e-14 73 27 5 217 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q72PQ2 1.49e-14 72 30 8 211 3 plsY Glycerol-3-phosphate acyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q3Z643 1.72e-14 73 40 0 106 3 plsY5 Glycerol-3-phosphate acyltransferase 5 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
P59247 2.46e-14 72 30 8 211 3 plsY Glycerol-3-phosphate acyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q1MGK1 2.92e-14 72 33 3 211 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A1VY78 3.71e-14 71 30 5 200 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A2RLE8 4.37e-14 71 28 5 205 3 plsY Glycerol-3-phosphate acyltransferase Lactococcus lactis subsp. cremoris (strain MG1363)
A8FKE6 4.5e-14 71 30 5 200 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q9PIE4 5.7e-14 70 30 5 200 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q04ZS2 6.12e-14 71 32 11 220 3 plsY Glycerol-3-phosphate acyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04TV3 6.12e-14 71 32 11 220 3 plsY Glycerol-3-phosphate acyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q02ZM1 6.45e-14 71 28 5 205 3 plsY Glycerol-3-phosphate acyltransferase Lactococcus lactis subsp. cremoris (strain SK11)
Q9CGW4 1.28e-13 70 30 7 211 3 plsY Glycerol-3-phosphate acyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
P59249 1.61e-13 70 26 5 203 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2SSZ9 1.71e-13 70 33 2 160 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q7VHP1 2.7e-13 69 30 4 204 3 plsY Glycerol-3-phosphate acyltransferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q5HWB0 3.95e-13 68 29 5 200 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter jejuni (strain RM1221)
Q2RJ58 1.04e-12 67 31 6 193 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q5FMI9 1.04e-12 67 24 1 190 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q6MUC0 1.51e-12 68 33 2 160 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q3ZWB4 2.18e-12 67 37 1 108 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Dehalococcoides mccartyi (strain CBDB1)
Q7MAV0 1e-11 65 29 3 195 3 plsY Glycerol-3-phosphate acyltransferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P59248 1.04e-11 65 27 9 256 3 plsY Glycerol-3-phosphate acyltransferase Malacoplasma penetrans (strain HF-2)
P60927 1.61e-11 64 34 2 120 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q9X109 3.13e-10 60 31 3 112 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q2GD32 4.31e-10 60 27 3 186 3 plsY Glycerol-3-phosphate acyltransferase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q9RS57 9.69e-10 59 35 4 118 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q6F1C9 2.7e-09 58 34 1 117 3 plsY Glycerol-3-phosphate acyltransferase Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q3Z6K1 6.28e-09 57 36 0 98 3 plsY4 Glycerol-3-phosphate acyltransferase 4 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11690
Feature type CDS
Gene plsY
Product glycerol-3-phosphate 1-O-acyltransferase PlsY
Location 2583957 - 2584613 (strand: 1)
Length 657 (nucleotides) / 218 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2313
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02660 Glycerol-3-phosphate acyltransferase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0344 Lipid transport and metabolism (I) I Phospholipid biosynthesis protein PlsY, probable glycerol-3-phosphate acyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08591 acyl phosphate:glycerol-3-phosphate acyltransferase [EC:2.3.1.275] Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
-

Protein Sequence

MSANALGMIIFAYLCGSISSAILICRLARLPDPRKFGSGNPGATNVLRIGGKLAAASVLICDVLKGMIPVWLAYYLNVPPFYLGIVAIAACLGHIYPVFFHFKGGKGVATAFGSIAAIGWDLSGLIAGTWLLTVLLSGYSSLGAIISALLAPFYVWWFKPEFTYPVALLSCLVLYRHHDNIQRLWRGQESRIWHKLKKKTEKTDKEIIQEAKEQEKED

Flanking regions ( +/- flanking 50bp)

GTATTATCCATACATGTCTAACGAACGTTCATCAACATTGGAGAATACAAATGAGTGCTAACGCACTTGGAATGATCATCTTCGCCTATTTGTGCGGCTCAATCTCCAGCGCGATTTTGATTTGCCGACTGGCAAGACTCCCTGATCCAAGAAAATTTGGCTCTGGTAATCCTGGCGCCACCAATGTGCTACGTATTGGTGGTAAACTTGCAGCGGCATCTGTGCTTATCTGTGACGTCCTAAAAGGGATGATCCCCGTTTGGCTCGCCTATTACCTAAATGTGCCTCCCTTTTATCTCGGTATTGTCGCAATAGCGGCTTGTCTAGGCCATATTTACCCTGTTTTTTTCCACTTTAAAGGCGGAAAAGGGGTTGCTACTGCATTTGGCTCTATCGCTGCTATTGGTTGGGATCTTAGCGGACTGATTGCGGGAACATGGCTACTAACTGTTTTACTCAGTGGCTATTCCTCACTGGGTGCTATTATCAGTGCATTGCTTGCCCCATTTTATGTCTGGTGGTTTAAACCCGAATTCACTTATCCCGTTGCACTATTATCATGCTTAGTACTTTACCGTCATCATGACAATATTCAACGTTTATGGCGAGGACAAGAGAGTCGCATTTGGCATAAGCTGAAAAAAAAGACAGAGAAAACAGATAAAGAGATAATCCAAGAAGCCAAAGAGCAAGAAAAAGAAGATTAACGCTTATCCTTATTAAAAAAAGGTCATTTATTAACTAAGTGACCTTTTTT