Homologs in group_2278

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17510 FBDBKF_17510 100.0 Morganella morganii S1 plsY glycerol-3-phosphate 1-O-acyltransferase PlsY
EHELCC_17405 EHELCC_17405 100.0 Morganella morganii S2 plsY glycerol-3-phosphate 1-O-acyltransferase PlsY
LHKJJB_17710 LHKJJB_17710 100.0 Morganella morganii S3 plsY glycerol-3-phosphate 1-O-acyltransferase PlsY
HKOGLL_17720 HKOGLL_17720 100.0 Morganella morganii S5 plsY glycerol-3-phosphate 1-O-acyltransferase PlsY
F4V73_RS16685 F4V73_RS16685 95.9 Morganella psychrotolerans plsY glycerol-3-phosphate 1-O-acyltransferase PlsY
PMI_RS11690 PMI_RS11690 89.4 Proteus mirabilis HI4320 plsY glycerol-3-phosphate 1-O-acyltransferase PlsY

Distribution of the homologs in the orthogroup group_2278

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2278

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EW52 7.73e-133 375 89 0 218 3 plsY Glycerol-3-phosphate acyltransferase Proteus mirabilis (strain HI4320)
A1JQW7 2.93e-124 353 83 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7N0B7 6.84e-124 352 83 0 218 3 plsY Glycerol-3-phosphate acyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JM19 8.38e-124 352 83 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665U6 8.38e-124 352 83 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4THT2 8.38e-124 352 83 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pestis (strain Pestoides F)
Q1CME1 8.38e-124 352 83 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZI67 8.38e-124 352 83 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pestis
B2K2I2 8.38e-124 352 83 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C367 8.38e-124 352 83 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FE72 8.38e-124 352 83 0 203 3 plsY Glycerol-3-phosphate acyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6DDM0 5.51e-122 347 79 0 210 3 plsY Glycerol-3-phosphate acyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BHG2 4.63e-120 343 75 0 217 3 plsY Glycerol-3-phosphate acyltransferase Edwardsiella ictaluri (strain 93-146)
A8GJV0 2.37e-119 340 81 0 200 3 plsY Glycerol-3-phosphate acyltransferase Serratia proteamaculans (strain 568)
A9MPV6 4.86e-119 339 81 0 205 3 plsY Glycerol-3-phosphate acyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8APU2 3.42e-118 337 80 0 205 3 plsY Glycerol-3-phosphate acyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B4TVU1 4.6e-118 337 80 0 205 3 plsY Glycerol-3-phosphate acyltransferase Salmonella schwarzengrund (strain CVM19633)
A7MJT5 4.86e-118 337 80 0 205 3 plsY Glycerol-3-phosphate acyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
P67161 1.27e-117 336 81 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67162 1.27e-117 336 81 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella typhi
B5BG18 1.27e-117 336 81 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella paratyphi A (strain AKU_12601)
A9N5Y5 1.27e-117 336 81 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PC79 1.27e-117 336 81 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T677 1.27e-117 336 81 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella newport (strain SL254)
B4TI58 1.27e-117 336 81 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella heidelberg (strain SL476)
B5REG5 1.27e-117 336 81 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ43 1.27e-117 336 81 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella enteritidis PT4 (strain P125109)
B5FHU2 1.27e-117 336 81 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella dublin (strain CT_02021853)
Q57JQ2 1.27e-117 336 81 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella choleraesuis (strain SC-B67)
B5F6A3 1.27e-117 336 81 0 202 3 plsY Glycerol-3-phosphate acyltransferase Salmonella agona (strain SL483)
B2VGJ1 2.23e-117 335 81 0 200 3 plsY Glycerol-3-phosphate acyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6D157 3.28e-117 335 76 0 210 3 plsY Glycerol-3-phosphate acyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B7LQD7 4.75e-116 332 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q2NWE5 1.24e-115 331 77 1 206 3 plsY Glycerol-3-phosphate acyltransferase Sodalis glossinidius (strain morsitans)
Q3YXI3 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Shigella sonnei (strain Ss046)
Q32BQ6 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q31WX6 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Shigella boydii serotype 4 (strain Sb227)
B2U1G3 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R6S2 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain UTI89 / UPEC)
B1LF51 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B6I430 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain SE11)
B7ND48 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P60782 2.33e-115 330 80 1 206 1 plsY Probable glycerol-3-phosphate acyltransferase Escherichia coli (strain K12)
B1IRQ7 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P60783 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TD47 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AFY1 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O1:K1 / APEC
A8A4L4 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O9:H4 (strain HS)
B1XG64 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain K12 / DH10B)
C4ZQX6 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZK9 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O8 (strain IAI1)
B7N0K9 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O81 (strain ED1a)
B7NJS2 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YR99 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P60784 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O157:H7
B7LGZ5 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli (strain 55989 / EAEC)
B7MAZ5 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIW7 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZRU0 2.33e-115 330 80 1 206 3 plsY Glycerol-3-phosphate acyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
P59252 1.07e-114 328 79 1 206 3 plsY Glycerol-3-phosphate acyltransferase Shigella flexneri
Q0T0K4 1.07e-114 328 79 1 206 3 plsY Glycerol-3-phosphate acyltransferase Shigella flexneri serotype 5b (strain 8401)
B5XU32 2.48e-113 325 76 0 205 3 plsY Glycerol-3-phosphate acyltransferase Klebsiella pneumoniae (strain 342)
A6TE38 4.28e-112 322 76 0 205 3 plsY Glycerol-3-phosphate acyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WEJ1 6.39e-112 321 80 0 194 3 plsY Glycerol-3-phosphate acyltransferase Enterobacter sp. (strain 638)
P44603 7.28e-99 288 67 0 199 3 plsY Glycerol-3-phosphate acyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UG86 7.28e-99 288 67 0 199 3 plsY Glycerol-3-phosphate acyltransferase Haemophilus influenzae (strain PittGG)
Q4QNS2 7.28e-99 288 67 0 199 3 plsY Glycerol-3-phosphate acyltransferase Haemophilus influenzae (strain 86-028NP)
A5UAM4 1.3e-98 287 67 0 199 3 plsY Glycerol-3-phosphate acyltransferase Haemophilus influenzae (strain PittEE)
Q6LV09 1.58e-98 287 67 0 199 3 plsY Glycerol-3-phosphate acyltransferase Photobacterium profundum (strain SS9)
Q9CKC7 4.7e-98 286 67 0 200 3 plsY Glycerol-3-phosphate acyltransferase Pasteurella multocida (strain Pm70)
A6VQI5 9.18e-96 280 65 0 200 3 plsY Glycerol-3-phosphate acyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65RI0 1.44e-94 277 65 0 200 3 plsY Glycerol-3-phosphate acyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B5FB81 2.88e-94 276 65 0 195 3 plsY Glycerol-3-phosphate acyltransferase Aliivibrio fischeri (strain MJ11)
Q5E2K3 2.88e-94 276 65 0 195 3 plsY Glycerol-3-phosphate acyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B8F6X1 5.07e-94 276 65 0 200 3 plsY Glycerol-3-phosphate acyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
C3LS13 5.02e-93 274 61 0 208 3 plsY Glycerol-3-phosphate acyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KUJ7 5.02e-93 274 61 0 208 3 plsY Glycerol-3-phosphate acyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F9D1 5.02e-93 274 61 0 208 3 plsY Glycerol-3-phosphate acyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7VIV7 1.54e-90 267 65 0 195 3 plsY Glycerol-3-phosphate acyltransferase Vibrio atlanticus (strain LGP32)
B6EM14 2.45e-90 266 65 0 193 3 plsY Glycerol-3-phosphate acyltransferase Aliivibrio salmonicida (strain LFI1238)
Q7MNZ7 4.28e-88 261 64 0 195 3 plsY Glycerol-3-phosphate acyltransferase Vibrio vulnificus (strain YJ016)
Q87SL3 9e-88 260 65 0 195 3 plsY Glycerol-3-phosphate acyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MWQ0 1.49e-87 259 65 0 195 3 plsY Glycerol-3-phosphate acyltransferase Vibrio campbellii (strain ATCC BAA-1116)
P59257 2.46e-87 259 63 0 195 3 plsY Glycerol-3-phosphate acyltransferase Vibrio vulnificus (strain CMCP6)
B0BQT0 5.01e-86 255 63 0 188 3 plsY Glycerol-3-phosphate acyltransferase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GYC1 5.01e-86 255 63 0 188 3 plsY Glycerol-3-phosphate acyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N1Y9 5.01e-86 255 63 0 188 3 plsY Glycerol-3-phosphate acyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A1RMH7 3.34e-85 254 62 0 197 3 plsY Glycerol-3-phosphate acyltransferase Shewanella sp. (strain W3-18-1)
A4Y4F4 3.34e-85 254 62 0 197 3 plsY Glycerol-3-phosphate acyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q0HG43 3.57e-85 253 62 1 200 3 plsY Glycerol-3-phosphate acyltransferase Shewanella sp. (strain MR-4)
P59251 5.01e-85 253 62 0 196 3 plsY Glycerol-3-phosphate acyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HSD6 1.14e-84 252 62 0 196 3 plsY Glycerol-3-phosphate acyltransferase Shewanella sp. (strain MR-7)
B1KHE3 1.26e-84 252 62 0 199 3 plsY Glycerol-3-phosphate acyltransferase Shewanella woodyi (strain ATCC 51908 / MS32)
Q7VMJ8 1.29e-84 252 61 0 199 3 plsY Glycerol-3-phosphate acyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A0KZT7 2.73e-84 251 62 0 196 3 plsY Glycerol-3-phosphate acyltransferase Shewanella sp. (strain ANA-3)
A4SI95 1.48e-83 250 55 0 218 3 plsY Glycerol-3-phosphate acyltransferase Aeromonas salmonicida (strain A449)
A3QBM4 1.01e-82 247 61 0 192 3 plsY Glycerol-3-phosphate acyltransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A8FS65 1.53e-81 244 60 0 197 3 plsY Glycerol-3-phosphate acyltransferase Shewanella sediminis (strain HAW-EB3)
Q12KB8 3.64e-81 243 58 0 197 3 plsY Glycerol-3-phosphate acyltransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q47W34 4.06e-80 241 59 0 193 3 plsY Glycerol-3-phosphate acyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q0I4T6 6.28e-80 240 58 1 198 3 plsY Glycerol-3-phosphate acyltransferase Histophilus somni (strain 129Pt)
Q15X19 1.4e-79 239 58 0 200 3 plsY Glycerol-3-phosphate acyltransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B0TIN9 6.12e-79 238 60 0 188 3 plsY Glycerol-3-phosphate acyltransferase Shewanella halifaxensis (strain HAW-EB4)
A9L5I4 4.16e-77 233 62 0 194 3 plsY Glycerol-3-phosphate acyltransferase Shewanella baltica (strain OS195)
A6WKK5 4.16e-77 233 62 0 194 3 plsY Glycerol-3-phosphate acyltransferase Shewanella baltica (strain OS185)
A3D1Q5 4.16e-77 233 62 0 194 3 plsY Glycerol-3-phosphate acyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBV4 4.16e-77 233 62 0 194 3 plsY Glycerol-3-phosphate acyltransferase Shewanella baltica (strain OS223)
Q5QY47 8.69e-75 227 56 1 200 3 plsY Glycerol-3-phosphate acyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3IHX2 1.04e-71 219 54 0 197 3 plsY Glycerol-3-phosphate acyltransferase Pseudoalteromonas translucida (strain TAC 125)
Q493X7 4.47e-69 213 54 0 186 3 plsY Glycerol-3-phosphate acyltransferase Blochmanniella pennsylvanica (strain BPEN)
C4LB58 4.5e-68 210 55 0 202 3 plsY Glycerol-3-phosphate acyltransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A0Q6X6 3.63e-56 180 47 1 201 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. novicida (strain U112)
Q2A3Z1 5.8e-56 179 47 1 201 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. holarctica (strain LVS)
A7NBL2 5.8e-56 179 47 1 201 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q0BMC8 5.86e-56 179 47 1 201 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. holarctica (strain OSU18)
B2SDD0 1.2e-55 179 46 1 201 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q5NFU6 8.24e-55 176 46 1 201 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14H98 8.24e-55 176 46 1 201 3 plsY Glycerol-3-phosphate acyltransferase Francisella tularensis subsp. tularensis (strain FSC 198)
B0TYY2 9.92e-55 176 46 1 201 3 plsY Glycerol-3-phosphate acyltransferase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q7VQQ8 3.93e-53 172 50 0 188 3 plsY Glycerol-3-phosphate acyltransferase Blochmanniella floridana
B8GPT8 4.05e-53 172 49 4 200 3 plsY Glycerol-3-phosphate acyltransferase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q3JF14 5.62e-53 172 49 1 186 3 plsY Glycerol-3-phosphate acyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q5X2T2 2.32e-50 167 49 1 187 3 plsY Glycerol-3-phosphate acyltransferase Legionella pneumophila (strain Paris)
Q5WU90 5.99e-50 166 49 1 190 3 plsY Glycerol-3-phosphate acyltransferase Legionella pneumophila (strain Lens)
A5IEF8 7.76e-50 166 45 2 213 3 plsY Glycerol-3-phosphate acyltransferase Legionella pneumophila (strain Corby)
Q5ZT09 2.12e-49 165 45 2 213 3 plsY Glycerol-3-phosphate acyltransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q602S2 1.29e-45 153 46 2 190 3 plsY Glycerol-3-phosphate acyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8XWC8 1.55e-45 153 50 5 192 3 plsY Glycerol-3-phosphate acyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q31EM0 2.74e-45 152 42 2 209 3 plsY Glycerol-3-phosphate acyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q7VXN3 6.88e-45 151 46 2 197 3 plsY Glycerol-3-phosphate acyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W669 6.88e-45 151 46 2 197 3 plsY Glycerol-3-phosphate acyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WI35 6.88e-45 151 46 2 197 3 plsY Glycerol-3-phosphate acyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A1AXL0 1.45e-44 150 44 3 184 3 plsY Glycerol-3-phosphate acyltransferase Ruthia magnifica subsp. Calyptogena magnifica
Q0KE35 3.7e-44 149 46 2 192 3 plsY Glycerol-3-phosphate acyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B2UB97 2.9e-43 147 47 4 194 3 plsY Glycerol-3-phosphate acyltransferase Ralstonia pickettii (strain 12J)
B2JDU2 3.23e-43 147 44 2 203 3 plsY Glycerol-3-phosphate acyltransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B3R0V4 4.18e-43 147 46 2 192 3 plsY Glycerol-3-phosphate acyltransferase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q475H6 4.76e-43 146 46 3 192 3 plsY Glycerol-3-phosphate acyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A1WZI0 1.24e-42 145 48 3 189 3 plsY Glycerol-3-phosphate acyltransferase Halorhodospira halophila (strain DSM 244 / SL1)
Q1IG30 2.81e-42 144 42 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas entomophila (strain L48)
Q1LR23 3.3e-42 144 44 2 194 3 plsY Glycerol-3-phosphate acyltransferase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q21UZ2 5.52e-42 144 39 2 206 3 plsY Glycerol-3-phosphate acyltransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A9IP09 7.06e-42 144 45 2 199 3 plsY Glycerol-3-phosphate acyltransferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q4ZMF5 1.41e-41 142 42 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q2Y7B5 4.52e-41 141 49 6 199 3 plsY Glycerol-3-phosphate acyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q13UQ8 4.9e-41 142 46 3 198 3 plsY Glycerol-3-phosphate acyltransferase Paraburkholderia xenovorans (strain LB400)
Q1GYU3 6.12e-41 141 48 1 190 3 plsY Glycerol-3-phosphate acyltransferase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B6IZN9 7.6e-41 140 43 1 185 3 plsY Glycerol-3-phosphate acyltransferase Coxiella burnetii (strain CbuG_Q212)
Q83C89 7.94e-41 140 43 1 185 3 plsY Glycerol-3-phosphate acyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NDU9 7.94e-41 140 43 1 185 3 plsY Glycerol-3-phosphate acyltransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KFT7 7.94e-41 140 43 1 185 3 plsY Glycerol-3-phosphate acyltransferase Coxiella burnetii (strain Dugway 5J108-111)
B6J7P8 7.94e-41 140 43 1 185 3 plsY Glycerol-3-phosphate acyltransferase Coxiella burnetii (strain CbuK_Q154)
B2SY66 8.37e-40 139 47 3 189 3 plsY Glycerol-3-phosphate acyltransferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q2S8V8 2.19e-39 137 43 0 181 3 plsY Glycerol-3-phosphate acyltransferase Hahella chejuensis (strain KCTC 2396)
A9AGJ3 3.02e-39 137 46 4 202 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia multivorans (strain ATCC 17616 / 249)
Q2L004 6.93e-39 136 44 2 197 3 plsY Glycerol-3-phosphate acyltransferase Bordetella avium (strain 197N)
Q3K5S2 2.43e-38 134 41 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q88QU5 3.51e-38 134 42 0 169 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q3JVC1 4.14e-38 134 47 2 191 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia pseudomallei (strain 1710b)
Q63WM5 4.92e-38 134 47 2 191 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia pseudomallei (strain K96243)
Q47IP1 5.79e-38 133 47 1 191 3 plsY Glycerol-3-phosphate acyltransferase Dechloromonas aromatica (strain RCB)
A6X570 6.44e-38 133 41 3 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q0BCG3 6.52e-38 134 48 4 200 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A5VXI5 6.7e-38 133 41 0 169 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q2T0L4 7.37e-38 133 45 4 203 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q6FZS3 7.54e-38 133 38 2 198 3 plsY Glycerol-3-phosphate acyltransferase Bartonella quintana (strain Toulouse)
B1YVE9 8e-38 133 48 3 193 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia ambifaria (strain MC40-6)
A1UT26 1.17e-37 133 39 4 202 3 plsY Glycerol-3-phosphate acyltransferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q6G3F5 1.21e-37 133 39 3 195 3 plsY Glycerol-3-phosphate acyltransferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q4K4W5 1.38e-37 132 42 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q39DI4 1.4e-37 133 46 2 199 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q89K17 1.84e-37 132 41 2 188 3 plsY Glycerol-3-phosphate acyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q62M79 2.38e-37 132 46 2 191 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia mallei (strain ATCC 23344)
A4JH88 6.13e-37 131 46 1 192 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q215Y7 8.67e-37 130 43 2 188 3 plsY Glycerol-3-phosphate acyltransferase Rhodopseudomonas palustris (strain BisB18)
B1JXG6 1.7e-36 130 47 3 200 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia orbicola (strain MC0-3)
B0KJ83 1.92e-36 129 40 0 169 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas putida (strain GB-1)
Q1BU57 2.44e-36 129 47 3 200 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia orbicola (strain AU 1054)
A0K9X9 2.44e-36 129 47 3 200 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia cenocepacia (strain HI2424)
Q48NU7 3.87e-36 128 43 0 179 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A6UZ84 4.92e-36 128 43 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas aeruginosa (strain PA7)
C3K337 5.02e-36 128 42 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas fluorescens (strain SBW25)
A8LL79 7.08e-36 128 47 4 186 3 plsY Glycerol-3-phosphate acyltransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q9I5V6 1.19e-35 127 43 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TI2 1.19e-35 127 43 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V4G7 1.19e-35 127 43 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas aeruginosa (strain LESB58)
Q7NRU2 1.25e-35 127 42 4 203 3 plsY Glycerol-3-phosphate acyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P59246 1.39e-35 127 41 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella suis biovar 1 (strain 1330)
A9MBP1 1.39e-35 127 41 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A9IU40 1.72e-35 127 39 2 196 3 plsY Glycerol-3-phosphate acyltransferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q9JUL4 1.94e-35 127 43 3 196 3 plsY Glycerol-3-phosphate acyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9WYS0 2.15e-35 127 41 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUT3 2.55e-35 127 41 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC64 2.84e-35 126 41 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RLC2 2.84e-35 126 41 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
Q2NB90 5.89e-35 125 39 3 189 3 plsY Glycerol-3-phosphate acyltransferase Erythrobacter litoralis (strain HTCC2594)
Q88A56 6.58e-35 125 42 0 182 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3SGB5 9.52e-35 125 43 3 188 3 plsY Glycerol-3-phosphate acyltransferase Thiobacillus denitrificans (strain ATCC 25259)
A4G2A5 1.54e-34 125 45 6 196 3 plsY Glycerol-3-phosphate acyltransferase Herminiimonas arsenicoxydans
Q135I3 1.56e-34 124 41 2 196 3 plsY Glycerol-3-phosphate acyltransferase Rhodopseudomonas palustris (strain BisB5)
Q2W158 1.75e-34 124 41 2 188 3 plsY Glycerol-3-phosphate acyltransferase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A6U809 2.75e-34 124 41 3 192 3 plsY Glycerol-3-phosphate acyltransferase Sinorhizobium medicae (strain WSM419)
A6SV70 2.81e-34 124 46 6 194 3 plsY Glycerol-3-phosphate acyltransferase Janthinobacterium sp. (strain Marseille)
B4E9G9 4.79e-34 124 47 3 200 3 plsY Glycerol-3-phosphate acyltransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q578A0 6.93e-34 123 40 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella abortus biovar 1 (strain 9-941)
Q2YKM0 6.93e-34 123 40 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella abortus (strain 2308)
B2SB55 6.93e-34 123 40 2 191 3 plsY Glycerol-3-phosphate acyltransferase Brucella abortus (strain S19)
B4RLD8 1.18e-33 122 44 3 193 3 plsY Glycerol-3-phosphate acyltransferase Neisseria gonorrhoeae (strain NCCP11945)
Q5F8C7 1.18e-33 122 44 3 193 3 plsY Glycerol-3-phosphate acyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1KTU8 1.66e-33 122 41 3 196 3 plsY Glycerol-3-phosphate acyltransferase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A9LYY1 2.22e-33 122 43 3 193 3 plsY Glycerol-3-phosphate acyltransferase Neisseria meningitidis serogroup C (strain 053442)
Q3SR23 2.48e-33 121 42 3 192 3 plsY Glycerol-3-phosphate acyltransferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q9JZG9 4.1e-33 121 43 3 193 3 plsY Glycerol-3-phosphate acyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
C1DCY1 5.01e-33 120 44 3 197 3 plsY Glycerol-3-phosphate acyltransferase Laribacter hongkongensis (strain HLHK9)
P59250 6.84e-33 120 40 2 182 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B9M1A8 7.74e-33 120 42 5 187 3 plsY Glycerol-3-phosphate acyltransferase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B1JDY4 1.15e-32 119 40 0 169 3 plsY Glycerol-3-phosphate acyltransferase Pseudomonas putida (strain W619)
A4WP17 1.17e-32 120 40 3 195 3 plsY Glycerol-3-phosphate acyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q0AJ92 5.4e-32 118 45 2 191 3 plsY Glycerol-3-phosphate acyltransferase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
O66905 1.06e-31 117 40 3 190 1 plsY Glycerol-3-phosphate acyltransferase Aquifex aeolicus (strain VF5)
A5IMD8 1.3e-31 117 38 1 184 3 plsY Glycerol-3-phosphate acyltransferase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q182W4 1.95e-31 117 38 6 195 3 plsY Glycerol-3-phosphate acyltransferase Clostridioides difficile (strain 630)
Q3A6U7 2.46e-31 116 42 5 191 3 plsY Glycerol-3-phosphate acyltransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q2IXD3 2.66e-31 116 40 2 194 3 plsY Glycerol-3-phosphate acyltransferase Rhodopseudomonas palustris (strain HaA2)
C1DIY2 2.91e-31 115 41 0 182 3 plsY Glycerol-3-phosphate acyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q1QL21 4.43e-31 115 41 3 194 3 plsY Glycerol-3-phosphate acyltransferase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q8R9J2 7.02e-31 115 38 6 195 3 plsY Glycerol-3-phosphate acyltransferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B9KNF0 8.18e-31 115 41 3 189 3 plsY Glycerol-3-phosphate acyltransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IZ47 8.18e-31 115 41 3 189 3 plsY Glycerol-3-phosphate acyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PN50 8.18e-31 115 41 3 189 3 plsY Glycerol-3-phosphate acyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q834K7 1.26e-30 115 37 4 200 3 plsY Glycerol-3-phosphate acyltransferase Enterococcus faecalis (strain ATCC 700802 / V583)
A6TS38 1.29e-30 114 37 3 193 3 plsY Glycerol-3-phosphate acyltransferase Alkaliphilus metalliredigens (strain QYMF)
Q98M84 1.32e-30 114 41 3 189 3 plsY Glycerol-3-phosphate acyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1IPR1 1.54e-30 115 40 4 200 3 plsY Glycerol-3-phosphate acyltransferase Koribacter versatilis (strain Ellin345)
A7Z575 2.33e-30 114 37 2 186 3 plsY Glycerol-3-phosphate acyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
C4XH52 2.63e-30 114 36 4 199 3 plsY Glycerol-3-phosphate acyltransferase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q92QL7 2.77e-30 114 39 2 191 3 plsY Glycerol-3-phosphate acyltransferase Rhizobium meliloti (strain 1021)
P60926 3.51e-30 113 37 4 183 3 plsY Glycerol-3-phosphate acyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B1GZE4 4.04e-30 113 39 4 194 3 plsY Glycerol-3-phosphate acyltransferase Endomicrobium trichonymphae
B3E8I3 5.45e-30 112 40 4 183 3 plsY Glycerol-3-phosphate acyltransferase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q9X1F9 6.74e-30 112 39 3 185 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q5NN91 7.27e-30 113 41 3 203 3 plsY Glycerol-3-phosphate acyltransferase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q0AXC2 7.39e-30 112 37 2 190 3 plsY Glycerol-3-phosphate acyltransferase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B0K8N4 1.07e-29 112 38 4 193 3 plsY Glycerol-3-phosphate acyltransferase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B3Q9X6 1.14e-29 112 40 2 201 3 plsY Glycerol-3-phosphate acyltransferase Rhodopseudomonas palustris (strain TIE-1)
P60929 1.14e-29 112 40 2 201 3 plsY Glycerol-3-phosphate acyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q2GI73 1.72e-29 111 34 2 186 3 plsY Glycerol-3-phosphate acyltransferase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
A6LL73 2.56e-29 111 37 4 184 3 plsY Glycerol-3-phosphate acyltransferase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B0K3E3 2.85e-29 111 38 4 193 3 plsY Glycerol-3-phosphate acyltransferase Thermoanaerobacter sp. (strain X514)
Q73GB4 3.06e-29 110 36 2 188 3 plsY Glycerol-3-phosphate acyltransferase Wolbachia pipientis wMel
Q1QYX9 4.65e-29 110 36 1 199 3 plsY Glycerol-3-phosphate acyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A4YWG6 7.97e-29 110 40 2 188 3 plsY Glycerol-3-phosphate acyltransferase Bradyrhizobium sp. (strain ORS 278)
Q317C3 8.12e-29 110 37 4 194 3 plsY Glycerol-3-phosphate acyltransferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B8GZK4 8.46e-29 110 38 3 201 3 plsY Glycerol-3-phosphate acyltransferase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5K1 8.46e-29 110 38 3 201 3 plsY Glycerol-3-phosphate acyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B9JVI2 2.31e-28 108 40 3 196 3 plsY Glycerol-3-phosphate acyltransferase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
C6BRS7 3.03e-28 108 35 4 191 3 plsY Glycerol-3-phosphate acyltransferase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A5EKR0 3.37e-28 108 39 2 188 3 plsY Glycerol-3-phosphate acyltransferase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q46JD9 6.61e-28 107 36 2 193 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain NATL2A)
B1YEC6 7.81e-28 107 39 6 201 3 plsY Glycerol-3-phosphate acyltransferase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q8UFU1 8.22e-28 107 44 2 184 3 plsY Glycerol-3-phosphate acyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8RFY9 1.2e-27 107 33 2 186 3 plsY Glycerol-3-phosphate acyltransferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q82XN3 1.24e-27 107 43 2 195 3 plsY Glycerol-3-phosphate acyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5GSL3 2.22e-27 106 35 2 185 3 plsY Glycerol-3-phosphate acyltransferase Wolbachia sp. subsp. Brugia malayi (strain TRS)
A8G6D8 2.32e-27 106 37 2 193 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain MIT 9215)
B9DP57 3.12e-27 105 34 3 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus carnosus (strain TM300)
A2C4A0 3.24e-27 105 37 3 193 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain NATL1A)
Q65J17 3.48e-27 105 37 3 193 3 plsY Glycerol-3-phosphate acyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q5WGU3 3.73e-27 105 38 4 196 3 plsY Glycerol-3-phosphate acyltransferase Shouchella clausii (strain KSM-K16)
Q319G0 4.36e-27 105 36 2 193 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain MIT 9312)
A3PEG1 5.01e-27 105 38 2 192 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain MIT 9301)
A2BSP9 5.11e-27 105 36 2 193 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain AS9601)
Q1MIH8 5.55e-27 105 40 4 198 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2RIV5 8.53e-27 104 40 4 192 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q5P260 1.16e-26 104 43 4 181 3 plsY Glycerol-3-phosphate acyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q1MRX2 1.26e-26 104 37 4 188 3 plsY Glycerol-3-phosphate acyltransferase Lawsonia intracellularis (strain PHE/MN1-00)
Q3K0U5 1.32e-26 104 35 3 211 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q49XE7 1.46e-26 104 36 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q39R89 1.88e-26 103 38 2 177 3 plsY Glycerol-3-phosphate acyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q4FLQ2 3.41e-26 103 36 2 180 3 plsY Glycerol-3-phosphate acyltransferase Pelagibacter ubique (strain HTCC1062)
Q3Z6P4 4.44e-26 103 36 6 207 3 plsY3 Glycerol-3-phosphate acyltransferase 3 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q45064 4.78e-26 102 33 2 186 1 plsY Glycerol-3-phosphate acyltransferase Bacillus subtilis (strain 168)
Q6AQV6 4.95e-26 102 35 4 192 3 plsY Glycerol-3-phosphate acyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A2BY34 5.13e-26 102 36 2 190 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain MIT 9515)
A8F7S3 5.78e-26 102 36 3 201 3 plsY Glycerol-3-phosphate acyltransferase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q3YT97 6.68e-26 102 35 2 191 3 plsY Glycerol-3-phosphate acyltransferase Ehrlichia canis (strain Jake)
Q2K9P7 8.65e-26 102 39 3 198 3 plsY Glycerol-3-phosphate acyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q7NMV2 1.21e-25 102 37 3 196 3 plsY Glycerol-3-phosphate acyltransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q28KD9 1.22e-25 102 41 2 180 3 plsY Glycerol-3-phosphate acyltransferase Jannaschia sp. (strain CCS1)
Q1WTS7 1.65e-25 101 31 2 200 3 plsY Glycerol-3-phosphate acyltransferase Ligilactobacillus salivarius (strain UCC118)
Q3AAU7 8.1e-25 99 36 2 188 3 plsY Glycerol-3-phosphate acyltransferase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P67167 8.32e-25 100 34 3 207 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P67166 8.32e-25 100 34 3 207 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus agalactiae serotype III (strain NEM316)
Q88W28 8.98e-25 99 32 5 206 3 plsY Glycerol-3-phosphate acyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q3ZYV4 9.41e-25 100 35 6 209 3 plsY3 Glycerol-3-phosphate acyltransferase 3 Dehalococcoides mccartyi (strain CBDB1)
B8J229 9.6e-25 100 35 4 185 3 plsY Glycerol-3-phosphate acyltransferase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B3CMU6 9.77e-25 99 33 2 185 3 plsY Glycerol-3-phosphate acyltransferase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
C3MA95 1.12e-24 99 42 4 189 3 plsY Glycerol-3-phosphate acyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A7GQU4 1.17e-24 99 35 3 194 3 plsY Glycerol-3-phosphate acyltransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q2RPF8 1.36e-24 99 41 4 206 3 plsY Glycerol-3-phosphate acyltransferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q4L661 1.51e-24 99 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus haemolyticus (strain JCSC1435)
B3PW35 2.02e-24 99 38 3 198 3 plsY Glycerol-3-phosphate acyltransferase Rhizobium etli (strain CIAT 652)
Q24VA3 2.04e-24 98 38 5 188 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Desulfitobacterium hafniense (strain Y51)
A7HIH5 2.21e-24 98 35 5 201 3 plsY Glycerol-3-phosphate acyltransferase Anaeromyxobacter sp. (strain Fw109-5)
B5XL22 2.43e-24 99 35 2 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M49 (strain NZ131)
P0DD11 2.43e-24 99 35 2 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48U03 2.43e-24 99 35 2 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2REZ8 2.43e-24 99 35 2 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J722 2.43e-24 99 35 2 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JHA3 2.43e-24 99 35 2 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JM58 2.43e-24 99 35 2 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JC74 2.43e-24 99 35 2 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M12 (strain MGAS2096)
P67170 2.43e-24 99 35 2 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCK1 2.43e-24 99 35 2 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DD10 2.43e-24 99 35 2 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P67168 2.43e-24 99 35 2 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pyogenes serotype M1
P60928 2.66e-24 99 34 4 210 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A8Z223 3.13e-24 98 34 3 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
A6QGQ6 3.13e-24 98 34 3 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain Newman)
Q5HG66 3.13e-24 98 34 3 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain COL)
Q2FYS6 3.13e-24 98 34 3 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH82 3.13e-24 98 34 3 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain USA300)
Q6HFJ3 4.05e-24 97 34 3 195 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q726E5 4.07e-24 100 37 6 191 3 plsY Glycerol-3-phosphate acyltransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q9ZAF3 4.42e-24 97 36 3 194 3 plsY Glycerol-3-phosphate acyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q0ANY0 5.28e-24 97 37 4 193 3 plsY Glycerol-3-phosphate acyltransferase Maricaulis maris (strain MCS10)
C0M7J7 6.05e-24 97 33 2 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus equi subsp. equi (strain 4047)
Q5SJ11 6.2e-24 97 36 3 194 3 plsY Glycerol-3-phosphate acyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
C0ME59 7.88e-24 97 32 2 210 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus equi subsp. zooepidemicus (strain H70)
Q81Y92 8.15e-24 97 34 3 195 3 plsY3 Glycerol-3-phosphate acyltransferase 3 Bacillus anthracis
A4J3P2 8.72e-24 97 37 1 190 3 plsY Glycerol-3-phosphate acyltransferase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B7IRQ1 8.87e-24 97 34 3 195 3 plsY Glycerol-3-phosphate acyltransferase Bacillus cereus (strain G9842)
Q812Z6 8.87e-24 97 34 3 195 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
C1CS41 9.41e-24 97 34 3 199 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain Taiwan19F-14)
Q2GLU7 1.06e-23 96 36 5 187 3 plsY Glycerol-3-phosphate acyltransferase Anaplasma phagocytophilum (strain HZ)
Q9KCD3 1.39e-23 96 35 5 198 3 plsY Glycerol-3-phosphate acyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5KZ35 1.55e-23 96 35 2 179 3 plsY Glycerol-3-phosphate acyltransferase Geobacillus kaustophilus (strain HTA426)
C5DAS3 1.71e-23 96 33 2 187 3 plsY Glycerol-3-phosphate acyltransferase Geobacillus sp. (strain WCH70)
P67165 1.76e-23 96 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain MW2)
Q6G9K6 1.76e-23 96 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain MSSA476)
Q6GH52 1.76e-23 96 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain MRSA252)
P67164 1.76e-23 96 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain N315)
P67163 1.76e-23 96 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISN6 1.76e-23 96 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain JH9)
A6U1H4 1.76e-23 96 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain JH1)
A7X211 1.76e-23 96 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q7V0D9 2.33e-23 95 35 1 189 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q637M1 2.48e-23 95 34 3 195 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Bacillus cereus (strain ZK / E33L)
Q1IXF1 2.51e-23 95 37 3 189 3 plsY Glycerol-3-phosphate acyltransferase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B4U3D2 2.63e-23 96 33 1 195 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q2YXW4 2.64e-23 95 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q733N4 2.76e-23 95 34 3 195 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q2IH98 2.77e-23 95 37 8 203 3 plsY Glycerol-3-phosphate acyltransferase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q163C2 3.46e-23 95 37 2 187 3 plsY Glycerol-3-phosphate acyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B0S1N1 3.99e-23 95 33 4 191 3 plsY Glycerol-3-phosphate acyltransferase Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B4U9R1 4.28e-23 95 36 4 187 3 plsY Glycerol-3-phosphate acyltransferase Hydrogenobaculum sp. (strain Y04AAS1)
Q1DCA9 5.42e-23 94 38 3 188 3 plsY Glycerol-3-phosphate acyltransferase Myxococcus xanthus (strain DK1622)
B9EBV6 5.8e-23 94 33 4 184 3 plsY Glycerol-3-phosphate acyltransferase Macrococcus caseolyticus (strain JCSC5402)
Q5FF11 8.6e-23 94 35 2 190 3 plsY Glycerol-3-phosphate acyltransferase Ehrlichia ruminantium (strain Gardel)
Q5HCG2 9.87e-23 94 36 3 192 3 plsY Glycerol-3-phosphate acyltransferase Ehrlichia ruminantium (strain Welgevonden)
Q5LX62 1.04e-22 94 38 2 187 3 plsY Glycerol-3-phosphate acyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B7JUX4 1.14e-22 94 34 4 210 3 plsY Glycerol-3-phosphate acyltransferase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q8YZG8 1.14e-22 94 35 6 217 3 plsY Glycerol-3-phosphate acyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P59253 1.79e-22 93 31 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
C5CIV2 2.44e-22 93 35 5 201 3 plsY Glycerol-3-phosphate acyltransferase Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
Q38X02 3.65e-22 92 30 3 201 3 plsY Glycerol-3-phosphate acyltransferase Latilactobacillus sakei subsp. sakei (strain 23K)
Q1AU71 4.14e-22 92 38 3 177 3 plsY Glycerol-3-phosphate acyltransferase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q5HPI7 4.67e-22 92 31 4 194 3 plsY Glycerol-3-phosphate acyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P59256 8.16e-22 92 33 4 204 3 plsY Glycerol-3-phosphate acyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q3M918 8.17e-22 92 35 7 217 3 plsY Glycerol-3-phosphate acyltransferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q67NS8 8.96e-22 91 33 6 195 3 plsY Glycerol-3-phosphate acyltransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q92C68 1.2e-21 91 35 4 188 3 plsY Glycerol-3-phosphate acyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B1IB20 1.47e-21 91 33 3 199 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain Hungary19A-6)
C1CJU2 1.89e-21 91 33 3 199 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain P1031)
C1CDJ9 1.89e-21 91 33 3 199 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain JJA)
P0A4Q0 1.89e-21 91 33 3 199 1 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4P9 1.89e-21 91 33 3 199 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZNQ1 1.89e-21 91 33 3 199 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1C6I5 1.89e-21 91 33 3 199 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain 70585)
B5E3M4 1.89e-21 91 33 3 199 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae serotype 19F (strain G54)
Q04L63 1.89e-21 91 33 3 199 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B7KWA0 2.27e-21 90 38 3 189 3 plsY Glycerol-3-phosphate acyltransferase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B2INX0 2.31e-21 90 33 2 200 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus pneumoniae (strain CGSP14)
A9W739 2.37e-21 90 38 3 189 3 plsY Glycerol-3-phosphate acyltransferase Methylorubrum extorquens (strain PA1)
B1ZLL2 2.53e-21 90 39 3 189 3 plsY Glycerol-3-phosphate acyltransferase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q97G69 2.54e-21 90 34 8 193 3 plsY Glycerol-3-phosphate acyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q5FK09 3.04e-21 90 29 4 204 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q8Y7J3 3.17e-21 90 35 4 188 3 plsY Glycerol-3-phosphate acyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8JBQ8 4.27e-21 90 38 8 203 3 plsY Glycerol-3-phosphate acyltransferase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B8DG47 4.31e-21 89 35 4 188 3 plsY Glycerol-3-phosphate acyltransferase Listeria monocytogenes serotype 4a (strain HCC23)
Q720D7 4.31e-21 89 35 4 188 3 plsY Glycerol-3-phosphate acyltransferase Listeria monocytogenes serotype 4b (strain F2365)
C1L2J2 4.31e-21 89 35 4 188 3 plsY Glycerol-3-phosphate acyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
A7ZBZ7 4.42e-21 90 33 5 196 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter concisus (strain 13826)
Q03S76 5.41e-21 89 31 3 193 3 plsY Glycerol-3-phosphate acyltransferase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q7VAP9 5.88e-21 89 37 2 197 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
P75428 8.22e-21 90 32 8 237 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
B1I461 1.04e-20 89 34 4 197 3 plsY Glycerol-3-phosphate acyltransferase Desulforudis audaxviator (strain MP104C)
Q81N43 1.16e-20 88 34 3 187 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Bacillus anthracis
Q2S2H7 1.28e-20 89 32 3 208 3 plsY Glycerol-3-phosphate acyltransferase Salinibacter ruber (strain DSM 13855 / M31)
A3CN81 1.29e-20 89 35 3 194 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus sanguinis (strain SK36)
Q8KG75 1.37e-20 89 31 5 222 3 plsY Glycerol-3-phosphate acyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8L3A1 1.57e-20 89 30 7 214 3 plsY Glycerol-3-phosphate acyltransferase Acholeplasma laidlawii
Q2JPG8 1.73e-20 88 36 3 198 3 plsY Glycerol-3-phosphate acyltransferase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q98QR6 2.27e-20 88 32 7 220 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasmopsis pulmonis (strain UAB CTIP)
P73933 2.6e-20 88 34 8 209 3 plsY Glycerol-3-phosphate acyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q0C099 3.37e-20 87 40 4 191 3 plsY Glycerol-3-phosphate acyltransferase Hyphomonas neptunium (strain ATCC 15444)
A1BJJ2 3.8e-20 88 31 5 219 3 plsY Glycerol-3-phosphate acyltransferase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B3EPU8 5.64e-20 87 32 5 222 3 plsY Glycerol-3-phosphate acyltransferase Chlorobium phaeobacteroides (strain BS1)
Q9RSV1 8.28e-20 86 36 6 191 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q3B181 8.47e-20 87 30 5 225 3 plsY Glycerol-3-phosphate acyltransferase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B3QLQ4 9.26e-20 87 30 4 222 3 plsY Glycerol-3-phosphate acyltransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q3AZD7 9.6e-20 86 37 1 169 3 plsY Glycerol-3-phosphate acyltransferase Synechococcus sp. (strain CC9902)
B1V9H9 1.24e-19 86 31 6 215 3 plsY Glycerol-3-phosphate acyltransferase Phytoplasma australiense
B4UIV7 1.57e-19 85 35 7 203 3 plsY Glycerol-3-phosphate acyltransferase Anaeromyxobacter sp. (strain K)
Q7V5Y3 2.02e-19 85 37 4 193 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain MIT 9313)
Q2NJF6 2.16e-19 86 29 7 214 3 plsY Glycerol-3-phosphate acyltransferase Aster yellows witches'-broom phytoplasma (strain AYWB)
Q7U8N7 2.19e-19 85 37 1 166 3 plsY Glycerol-3-phosphate acyltransferase Parasynechococcus marenigrum (strain WH8102)
Q24Y16 2.42e-19 85 33 2 190 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Desulfitobacterium hafniense (strain Y51)
Q1GMR9 3.04e-19 85 40 2 185 3 plsY Glycerol-3-phosphate acyltransferase Ruegeria sp. (strain TM1040)
Q7NB93 3.21e-19 85 29 7 227 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q30ST6 3.38e-19 85 35 5 195 3 plsY Glycerol-3-phosphate acyltransferase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B1X0W5 3.93e-19 85 35 3 183 3 plsY Glycerol-3-phosphate acyltransferase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q4A729 4e-19 85 29 9 227 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasmopsis synoviae (strain 53)
Q9X972 4.5e-19 85 35 2 194 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
P47489 9.63e-19 84 31 10 237 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P59255 1.2e-18 84 31 4 210 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q039D7 2.17e-18 82 32 4 203 3 plsY Glycerol-3-phosphate acyltransferase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WEB1 2.17e-18 82 32 4 203 3 plsY Glycerol-3-phosphate acyltransferase Lacticaseibacillus casei (strain BL23)
A5IYF1 2.28e-18 83 31 7 213 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
A0AI87 3.53e-18 82 34 3 187 3 plsY Glycerol-3-phosphate acyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q5N0E4 3.64e-18 82 37 6 204 3 plsY Glycerol-3-phosphate acyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31LI2 3.64e-18 82 37 6 204 3 plsY Glycerol-3-phosphate acyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B2G735 4.05e-18 82 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJM1 4.05e-18 82 34 4 194 3 plsY Glycerol-3-phosphate acyltransferase Limosilactobacillus reuteri (strain DSM 20016)
A4SGV1 4.42e-18 82 28 4 225 3 plsY Glycerol-3-phosphate acyltransferase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q5FRH0 5.58e-18 82 39 6 215 3 plsY Glycerol-3-phosphate acyltransferase Gluconobacter oxydans (strain 621H)
Q5M5A4 6.92e-18 81 31 5 205 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M0R8 6.92e-18 81 31 5 205 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus thermophilus (strain CNRZ 1066)
B4S675 7.73e-18 82 30 5 219 3 plsY Glycerol-3-phosphate acyltransferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q3AP02 1.25e-17 81 27 4 225 3 plsY Glycerol-3-phosphate acyltransferase Chlorobium chlorochromatii (strain CaD3)
Q3AHU3 1.65e-17 80 36 1 168 3 plsY Glycerol-3-phosphate acyltransferase Synechococcus sp. (strain CC9605)
B3EI29 2.08e-17 80 28 4 225 3 plsY Glycerol-3-phosphate acyltransferase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A6Q218 2.47e-17 80 35 5 199 3 plsY Glycerol-3-phosphate acyltransferase Nitratiruptor sp. (strain SB155-2)
Q5P9D8 2.59e-17 79 33 5 189 3 plsY Glycerol-3-phosphate acyltransferase Anaplasma marginale (strain St. Maries)
B9KH94 2.73e-17 79 33 5 189 3 plsY Glycerol-3-phosphate acyltransferase Anaplasma marginale (strain Florida)
Q03LM3 3.88e-17 79 29 3 204 3 plsY Glycerol-3-phosphate acyltransferase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
A9BBV0 5.31e-17 79 36 3 188 3 plsY Glycerol-3-phosphate acyltransferase Prochlorococcus marinus (strain MIT 9211)
Q10ZX6 5.63e-17 79 30 3 219 3 plsY Glycerol-3-phosphate acyltransferase Trichodesmium erythraeum (strain IMS101)
Q1CRF2 1.69e-16 78 31 4 212 3 plsY Glycerol-3-phosphate acyltransferase Helicobacter pylori (strain HPAG1)
Q81DG8 2.83e-16 76 35 3 139 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2JV01 3.05e-16 77 35 2 185 3 plsY Glycerol-3-phosphate acyltransferase Synechococcus sp. (strain JA-3-3Ab)
B9KEQ5 3.15e-16 77 30 5 202 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
P60823 3.27e-16 76 36 6 157 3 plsY Glycerol-3-phosphate acyltransferase Onion yellows phytoplasma (strain OY-M)
Q9ZJB1 3.38e-16 77 31 5 212 3 plsY Glycerol-3-phosphate acyltransferase Helicobacter pylori (strain J99 / ATCC 700824)
Q2G7D3 3.67e-16 76 40 3 191 3 plsY Glycerol-3-phosphate acyltransferase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
O26039 4.41e-16 77 31 5 212 3 plsY Glycerol-3-phosphate acyltransferase Helicobacter pylori (strain ATCC 700392 / 26695)
Q17ZJ0 5.83e-16 76 31 6 214 3 plsY Glycerol-3-phosphate acyltransferase Helicobacter acinonychis (strain Sheeba)
Q0BTZ8 9.34e-16 75 32 4 201 3 plsY Glycerol-3-phosphate acyltransferase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B0CCQ8 1.62e-15 75 35 6 216 3 plsY Glycerol-3-phosphate acyltransferase Acaryochloris marina (strain MBIC 11017)
Q2SSZ9 2.26e-15 75 34 3 163 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
A2RLE8 2.6e-15 74 30 2 202 3 plsY Glycerol-3-phosphate acyltransferase Lactococcus lactis subsp. cremoris (strain MG1363)
B4SGX7 4.17e-15 74 27 4 225 3 plsY Glycerol-3-phosphate acyltransferase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A5UZW0 4.17e-15 73 33 5 200 3 plsY Glycerol-3-phosphate acyltransferase Roseiflexus sp. (strain RS-1)
Q81QF8 4.51e-15 73 30 2 170 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Bacillus anthracis
Q6MUC0 5.55e-15 74 36 3 163 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q6KIH2 6.3e-15 74 26 5 217 3 plsY Glycerol-3-phosphate acyltransferase Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q3ZW79 1.33e-14 73 38 0 113 3 plsY4 Glycerol-3-phosphate acyltransferase 4 Dehalococcoides mccartyi (strain CBDB1)
Q02ZM1 1.87e-14 72 30 2 192 3 plsY Glycerol-3-phosphate acyltransferase Lactococcus lactis subsp. cremoris (strain SK11)
Q63BB0 2.3e-14 71 31 4 166 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Bacillus cereus (strain ZK / E33L)
B5ZBQ1 2.59e-14 72 28 7 225 3 plsY Glycerol-3-phosphate acyltransferase Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
A8EWC8 4.21e-14 71 30 4 195 3 plsY Glycerol-3-phosphate acyltransferase Aliarcobacter butzleri (strain RM4018)
Q9PQ85 4.52e-14 72 27 6 237 3 plsY Glycerol-3-phosphate acyltransferase Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AJ44 4.52e-14 72 27 6 237 3 plsY Glycerol-3-phosphate acyltransferase Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Q6HIP2 6.3e-14 70 30 4 166 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
P59249 6.54e-14 70 25 4 203 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A7H515 8.96e-14 70 29 5 199 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q7VHP1 1.22e-13 70 30 4 213 3 plsY Glycerol-3-phosphate acyltransferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9CGW4 2.95e-13 69 29 4 206 3 plsY Glycerol-3-phosphate acyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
Q72PQ2 8.12e-13 68 32 9 195 3 plsY Glycerol-3-phosphate acyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
P59247 1.27e-12 67 32 9 195 3 plsY Glycerol-3-phosphate acyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q3Z643 1.45e-12 67 38 0 113 3 plsY5 Glycerol-3-phosphate acyltransferase 5 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q2RJ58 1.97e-12 66 31 6 193 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P59248 2.24e-12 67 28 10 253 3 plsY Glycerol-3-phosphate acyltransferase Malacoplasma penetrans (strain HF-2)
Q2GD32 3.1e-12 66 27 3 184 3 plsY Glycerol-3-phosphate acyltransferase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q9PIE4 4.15e-12 65 27 4 193 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q1MGK1 5.68e-12 65 33 5 209 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A1VY78 5.69e-12 65 27 4 193 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FKE6 7.79e-12 65 27 4 193 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q737Z5 8e-12 64 30 2 170 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q04ZS2 1.56e-11 64 29 9 220 3 plsY Glycerol-3-phosphate acyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04TV3 1.56e-11 64 29 9 220 3 plsY Glycerol-3-phosphate acyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q5HWB0 2.39e-11 63 27 4 193 3 plsY Glycerol-3-phosphate acyltransferase Campylobacter jejuni (strain RM1221)
Q3ZWB4 5.83e-11 62 38 1 108 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Dehalococcoides mccartyi (strain CBDB1)
P60927 1.16e-10 62 34 4 135 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q5FMI9 2.01e-10 61 24 3 192 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q7MAV0 2.53e-10 61 29 3 195 3 plsY Glycerol-3-phosphate acyltransferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q9X109 4.96e-09 57 33 4 112 3 plsY1 Glycerol-3-phosphate acyltransferase 1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q6F1C9 6.26e-08 55 35 3 120 3 plsY Glycerol-3-phosphate acyltransferase Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q9RS57 7.25e-08 54 36 4 122 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q3ZXW1 1.44e-07 53 29 6 204 3 plsY2 Glycerol-3-phosphate acyltransferase 2 Dehalococcoides mccartyi (strain CBDB1)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_17790
Feature type CDS
Gene plsY
Product glycerol-3-phosphate 1-O-acyltransferase PlsY
Location 6132 - 6788 (strand: -1)
Length 657 (nucleotides) / 218 (amino acids)

Contig

Accession ZDB_538
Length 42795 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2278
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02660 Glycerol-3-phosphate acyltransferase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0344 Lipid transport and metabolism (I) I Phospholipid biosynthesis protein PlsY, probable glycerol-3-phosphate acyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08591 acyl phosphate:glycerol-3-phosphate acyltransferase [EC:2.3.1.275] Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
-

Protein Sequence

MSGIALGMIIFAYLLGSISSAILICRLAGLPDPRHHGSGNPGATNVLRIGGKLAAAGVLICDVLKGMLPVWLAYLLQIPYFYLGIIAIAACLGHIYPVFFHFKGGKGVATAFGSIAAIGWDLTGLVAGTWLLTVLLSGYSSLGAIVSALVAPFYVWWFKPEFTFPVAMLSCLVLIRHHDNIQRLWRGQESRIWQKLKKKRAKTDKEIIQEAKEQEKED

Flanking regions ( +/- flanking 50bp)

TTATCCATGGAGGCCAATAACTGTAATTTACCGTCTGTCAGGAGAGAAGCATGAGTGGAATCGCGCTTGGTATGATCATCTTCGCTTATCTGCTGGGATCAATTTCCAGTGCGATCCTGATCTGCCGTCTTGCGGGACTGCCGGATCCGCGGCATCACGGCTCCGGAAACCCGGGGGCGACCAACGTGCTGCGCATCGGCGGCAAACTGGCGGCTGCCGGTGTCCTTATCTGCGACGTACTCAAGGGTATGCTGCCGGTCTGGCTCGCTTACCTCCTGCAAATACCGTATTTTTACCTCGGCATTATCGCCATTGCCGCCTGTTTAGGCCATATTTATCCGGTATTTTTCCACTTTAAAGGCGGAAAAGGCGTGGCAACGGCATTTGGTTCGATTGCCGCTATCGGCTGGGATCTGACCGGACTGGTTGCCGGAACCTGGCTGCTGACCGTGCTGCTGAGCGGTTATTCATCATTAGGCGCGATTGTCAGTGCGCTGGTGGCACCGTTTTATGTCTGGTGGTTCAAACCGGAGTTTACCTTCCCGGTCGCCATGCTCTCCTGCCTGGTGCTTATCCGCCATCATGACAATATTCAGCGGTTGTGGCGCGGACAGGAAAGCCGCATCTGGCAGAAGCTGAAGAAAAAGCGGGCCAAAACGGATAAAGAGATAATTCAGGAAGCGAAAGAGCAGGAAAAAGAAGATTAAAAAAAGGCGCTGAGGCGCCTTTTTTGTGTCCGGAAATTATTTGTCCAGCG