Homologs in group_2312

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17505 FBDBKF_17505 70.7 Morganella morganii S1 folB bifunctional dihydroneopterin aldolase/7,8-dihydroneopterin epimerase
EHELCC_17400 EHELCC_17400 70.7 Morganella morganii S2 folB bifunctional dihydroneopterin aldolase/7,8-dihydroneopterin epimerase
NLDBIP_17795 NLDBIP_17795 70.7 Morganella morganii S4 folB bifunctional dihydroneopterin aldolase/7,8-dihydroneopterin epimerase
LHKJJB_17715 LHKJJB_17715 70.7 Morganella morganii S3 folB bifunctional dihydroneopterin aldolase/7,8-dihydroneopterin epimerase
HKOGLL_17725 HKOGLL_17725 70.7 Morganella morganii S5 folB bifunctional dihydroneopterin aldolase/7,8-dihydroneopterin epimerase
F4V73_RS16680 F4V73_RS16680 69.0 Morganella psychrotolerans folB bifunctional dihydroneopterin aldolase/7,8-dihydroneopterin epimerase

Distribution of the homologs in the orthogroup group_2312

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2312

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AC18 5.2e-57 175 71 0 114 3 folB Dihydroneopterin aldolase Shigella flexneri
P0AC16 5.2e-57 175 71 0 114 1 folB Dihydroneopterin aldolase Escherichia coli (strain K12)
P0AC17 5.2e-57 175 71 0 114 3 folB Dihydroneopterin aldolase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P46362 1.7e-46 148 63 0 114 1 folB Dihydroneopterin aldolase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q54YD9 3.85e-13 67 34 0 114 3 fol1 Folic acid synthesis protein FOL1 Dictyostelium discoideum
P28823 3.17e-11 58 32 1 100 3 folB Dihydroneopterin aldolase Bacillus subtilis (strain 168)
Q9HYG7 3.31e-11 58 27 0 112 1 folX Dihydroneopterin triphosphate 2'-epimerase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P71513 2.89e-10 56 29 2 103 3 folB Dihydroneopterin aldolase Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
P0A3E2 4.76e-08 50 27 1 117 3 folB Dihydroneopterin aldolase Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0C0G5 4.76e-08 50 27 1 117 3 folB Dihydroneopterin aldolase Streptococcus pyogenes serotype M1
Q5XCA7 4.81e-08 50 27 1 117 3 folB Dihydroneopterin aldolase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0AC22 5.01e-08 50 25 0 110 3 folX Dihydroneopterin triphosphate 2'-epimerase Shigella flexneri
P0AC19 5.01e-08 50 25 0 110 1 folX Dihydroneopterin triphosphate 2'-epimerase Escherichia coli (strain K12)
P0AC20 5.01e-08 50 25 0 110 3 folX Dihydroneopterin triphosphate 2'-epimerase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC21 5.01e-08 50 25 0 110 3 folX Dihydroneopterin triphosphate 2'-epimerase Escherichia coli O157:H7
P0DB13 1.01e-07 50 27 1 117 3 folB Dihydroneopterin aldolase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DB12 1.01e-07 50 27 1 117 3 folB Dihydroneopterin aldolase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8CMT8 1.03e-07 50 30 2 116 3 folB Dihydroneopterin aldolase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRN9 1.03e-07 50 30 2 116 3 folB Dihydroneopterin aldolase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P53848 2.25e-07 51 28 1 88 1 FOL1 Folic acid synthesis protein FOL1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P53848 2e-06 48 28 3 114 1 FOL1 Folic acid synthesis protein FOL1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P74342 9.78e-07 47 24 0 98 3 folB Probable dihydroneopterin aldolase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P9WNC5 2.01e-06 46 30 0 100 1 folB Dihydroneopterin aldolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNC4 2.01e-06 46 30 0 100 3 folB Dihydroneopterin aldolase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A581 2.01e-06 46 30 0 100 3 folB Dihydroneopterin aldolase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P0C0G4 4.14e-06 45 25 1 117 3 folB Dihydroneopterin aldolase Streptococcus pyogenes
P29251 9.16e-06 46 26 1 114 1 fol1 Folic acid synthesis protein fol1 Pneumocystis carinii
P29251 3.66e-05 44 21 0 83 1 fol1 Folic acid synthesis protein fol1 Pneumocystis carinii
P56740 0.000265 40 25 2 116 1 folB Dihydroneopterin aldolase Staphylococcus aureus
Q6GJF6 0.000265 40 25 2 116 3 folB Dihydroneopterin aldolase Staphylococcus aureus (strain MRSA252)
P64147 0.000358 40 25 2 116 3 folB Dihydroneopterin aldolase Staphylococcus aureus (strain MW2)
Q6GBX3 0.000358 40 25 2 116 3 folB Dihydroneopterin aldolase Staphylococcus aureus (strain MSSA476)
P64146 0.000358 40 25 2 116 3 folB Dihydroneopterin aldolase Staphylococcus aureus (strain N315)
P64145 0.000358 40 25 2 116 3 folB Dihydroneopterin aldolase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIG0 0.000358 40 25 2 116 3 folB Dihydroneopterin aldolase Staphylococcus aureus (strain COL)
Q59920 0.000892 38 26 0 80 3 folB Dihydroneopterin aldolase (Fragment) Staphylococcus haemolyticus

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11685
Feature type CDS
Gene folB
Product bifunctional dihydroneopterin aldolase/7,8-dihydroneopterin epimerase
Location 2583502 - 2583852 (strand: -1)
Length 351 (nucleotides) / 116 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2312
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02152 Dihydroneopterin aldolase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1539 Coenzyme transport and metabolism (H) H Dihydroneopterin aldolase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01633 7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Folate biosynthesis
Metabolic pathways
Biosynthesis of cofactors
Tetrahydrofolate biosynthesis, GTP => THF
Tetrahydrofolate biosynthesis, mediated by ribA and trpF, GTP => THF

Protein Sequence

MDIVFIEQLSVITTIGVYDWEKTIKQKLVFDIEMEWDNKRASQTDDVAHCLDYASVSHAIIEYVEKRRFELVERVAEEVAQLLITQFSVPRVKIKLAKPGAIAQAANVGVIIERYA

Flanking regions ( +/- flanking 50bp)

ATTTCATCGGAAGTGGTATCCGATGAGCAGAAAAAATAAGAGATGACGTGATGGATATCGTATTTATTGAACAATTATCAGTAATAACCACAATCGGTGTTTATGATTGGGAAAAAACCATTAAGCAAAAGTTAGTGTTCGATATCGAAATGGAGTGGGATAATAAACGCGCATCCCAAACCGATGATGTTGCTCACTGTTTAGATTATGCCAGTGTCAGTCACGCCATAATAGAGTATGTGGAAAAGCGACGTTTTGAATTAGTCGAGCGTGTTGCTGAAGAAGTGGCACAGCTACTGATAACTCAGTTTTCTGTACCACGAGTCAAAATAAAATTAGCTAAACCAGGGGCGATAGCACAAGCCGCCAACGTCGGGGTGATTATTGAGCGTTACGCTTAATATTTGCCACACACAATAGTTAAAGTCGCGATTTCCATTCTATTATCGCG