Homologs in group_1160

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06245 FBDBKF_06245 63.4 Morganella morganii S1 djlA co-chaperone DjlA
EHELCC_09290 EHELCC_09290 63.4 Morganella morganii S2 djlA co-chaperone DjlA
NLDBIP_09670 NLDBIP_09670 63.4 Morganella morganii S4 djlA co-chaperone DjlA
LHKJJB_08085 LHKJJB_08085 63.4 Morganella morganii S3 djlA co-chaperone DjlA
HKOGLL_07635 HKOGLL_07635 63.4 Morganella morganii S5 djlA co-chaperone DjlA
F4V73_RS15675 F4V73_RS15675 62.5 Morganella psychrotolerans djlA co-chaperone DjlA

Distribution of the homologs in the orthogroup group_1160

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1160

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N8V3 7.99e-130 371 68 3 273 3 djlA Co-chaperone protein DjlA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7CR86 4.65e-118 342 60 1 270 3 djlA Co-chaperone protein DjlA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEM4 4.65e-118 342 60 1 270 3 djlA Co-chaperone protein DjlA Salmonella typhi
Q5PDE4 4.65e-118 342 60 1 270 3 djlA Co-chaperone protein DjlA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q7UDT6 9.12e-115 333 59 1 271 3 djlA Co-chaperone protein DjlA Shigella flexneri
P31680 9.12e-115 333 59 1 271 1 djlA Co-chaperone protein DjlA Escherichia coli (strain K12)
Q7AHS5 9.12e-115 333 59 1 271 3 djlA Co-chaperone protein DjlA Escherichia coli O157:H7
Q8FL94 1.05e-114 333 59 1 271 3 djlA Co-chaperone protein DjlA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q66EQ5 1.24e-108 318 60 2 277 3 djlA Co-chaperone protein DjlA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q74Q30 2.78e-108 317 60 2 277 3 djlA Co-chaperone protein DjlA Yersinia pestis
Q65RA1 1.64e-89 270 51 6 294 3 djlA Co-chaperone protein DjlA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44607 1.46e-87 265 48 4 291 3 djlA Co-chaperone protein DjlA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q6LV37 2.06e-87 264 59 3 227 3 djlA Co-chaperone protein DjlA Photobacterium profundum (strain SS9)
Q5E861 3.17e-86 261 53 4 259 3 djlA Co-chaperone protein DjlA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6D0E4 1.99e-85 259 51 6 287 3 djlA Co-chaperone protein DjlA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9CJW3 4.82e-85 258 51 5 291 3 djlA Co-chaperone protein DjlA Pasteurella multocida (strain Pm70)
Q8EB99 7.91e-84 254 48 4 272 3 djlA Co-chaperone protein DjlA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8DED6 5.37e-81 248 51 2 265 3 djlA Co-chaperone protein DjlA Vibrio vulnificus (strain CMCP6)
Q7MP82 1.09e-80 247 51 2 265 3 djlA Co-chaperone protein DjlA Vibrio vulnificus (strain YJ016)
Q87ST2 1.84e-78 241 52 3 257 3 djlA Co-chaperone protein DjlA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7VKU4 4.38e-78 241 48 3 287 3 djlA Co-chaperone protein DjlA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9KUR8 1.51e-73 229 47 3 263 3 djlA Co-chaperone protein DjlA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q45885 1.19e-53 177 40 7 271 3 djlA Co-chaperone protein DjlA Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q9X772 3.49e-49 167 33 5 287 3 djlA Co-chaperone protein DjlA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5CX57 1.89e-05 48 40 1 60 3 dnaJ Chaperone protein DnaJ Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q98PI9 3.48e-05 48 51 0 45 3 dnaJ Chaperone protein DnaJ Mycoplasmopsis pulmonis (strain UAB CTIP)
P14906 4.87e-05 48 41 1 65 1 SEC63 Protein translocation protein SEC63 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8EFW5 7.98e-05 43 38 1 62 1 atcJ Adaptation to cold protein J Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0A0D1E2P6 8.88e-05 47 62 0 32 1 DNJ1 Tetratricopeptide repeat and J domain-containing co-chaperone DNJ1 Ustilago maydis (strain 521 / FGSC 9021)
A0A0D2XVZ5 0.000207 45 41 1 60 3 DNJ1 Tetratricopeptide repeat and J domain-containing co-chaperone DNJ1 Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936)
A8AI78 0.000224 45 43 2 60 3 cbpA Curved DNA-binding protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7NLC5 0.00023 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7N3F5 0.000241 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7LFA9 0.000243 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli (strain 55989 / EAEC)
B2TTP8 0.00025 45 43 2 60 3 cbpA Curved DNA-binding protein Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RDL6 0.00025 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli (strain UTI89 / UPEC)
Q8FJ50 0.00025 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJ66 0.00025 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A9Q7 0.00025 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli O1:K1 / APEC
B7MPT2 0.00025 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli O81 (strain ED1a)
B7MIE6 0.00025 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UNY3 0.00025 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q7C254 0.000252 45 43 2 60 3 cbpA Curved DNA-binding protein Shigella flexneri
Q0T634 0.000252 45 43 2 60 3 cbpA Curved DNA-binding protein Shigella flexneri serotype 5b (strain 8401)
Q32HR2 0.000252 45 43 2 60 3 cbpA Curved DNA-binding protein Shigella dysenteriae serotype 1 (strain Sd197)
P36659 0.000252 45 43 2 60 1 cbpA Curved DNA-binding protein Escherichia coli (strain K12)
B1IV97 0.000252 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZYV2 0.000252 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli O9:H4 (strain HS)
B1X8V5 0.000252 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli (strain K12 / DH10B)
C4ZQC8 0.000252 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli (strain K12 / MC4100 / BW2952)
B5YU43 0.000254 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q7AFV7 0.000254 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli O157:H7
A9MH53 0.000257 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q601X8 0.00026 45 38 1 63 3 dnaJ Chaperone protein DnaJ Mesomycoplasma hyopneumoniae (strain 232)
Q31YR1 0.000261 45 43 2 60 3 cbpA Curved DNA-binding protein Shigella boydii serotype 4 (strain Sb227)
B6I976 0.000261 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli (strain SE11)
B7M8Y3 0.000261 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli O8 (strain IAI1)
A7ZKA5 0.000261 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli O139:H28 (strain E24377A / ETEC)
B3CVD9 0.000263 45 40 1 64 3 dnaJ Chaperone protein DnaJ Orientia tsutsugamushi (strain Ikeda)
B1LJ04 0.000266 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia coli (strain SMS-3-5 / SECEC)
P63263 0.000271 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63262 0.000271 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella typhi
B4TSM3 0.000271 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella schwarzengrund (strain CVM19633)
B5BBH2 0.000271 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella paratyphi A (strain AKU_12601)
C0Q893 0.000271 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella paratyphi C (strain RKS4594)
A9N6S2 0.000271 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PGA2 0.000271 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T2U5 0.000271 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella newport (strain SL254)
B4TEN5 0.000271 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella heidelberg (strain SL476)
B5R6G3 0.000271 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R049 0.000271 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella enteritidis PT4 (strain P125109)
B5FR40 0.000271 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella dublin (strain CT_02021853)
B5F1Z5 0.000271 45 43 2 60 3 cbpA Curved DNA-binding protein Salmonella agona (strain SL483)
Q3Z3C3 0.000273 45 43 2 60 3 cbpA Curved DNA-binding protein Shigella sonnei (strain Ss046)
B7LP19 0.000273 45 43 2 60 3 cbpA Curved DNA-binding protein Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A5CD86 0.000299 45 42 2 64 3 dnaJ Chaperone protein DnaJ Orientia tsutsugamushi (strain Boryong)
Q57QP2 0.000412 44 43 2 60 3 cbpA Curved DNA-binding protein Salmonella choleraesuis (strain SC-B67)
A5FZ18 0.000421 44 35 1 65 3 dnaJ Chaperone protein DnaJ Acidiphilium cryptum (strain JF-5)
B6IVA5 0.000497 44 35 1 64 3 dnaJ Chaperone protein DnaJ Rhodospirillum centenum (strain ATCC 51521 / SW)
O52065 0.001 43 38 1 60 3 dnaJ Chaperone protein DnaJ Mannheimia haemolytica
Q5F3Z5 0.001 43 36 1 66 2 DNAJB6 DnaJ homolog subfamily B member 6 Gallus gallus
Q6MNG0 0.001 43 41 1 62 3 dnaJ Chaperone protein DnaJ Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11525
Feature type CDS
Gene djlA
Product co-chaperone DjlA
Location 2541277 - 2542077 (strand: -1)
Length 801 (nucleotides) / 266 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1160
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00226 DnaJ domain
PF05099 Tellurite resistance protein TerB

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1076 Posttranslational modification, protein turnover, chaperones (O) O DnaJ domain-containing protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05801 DnaJ like chaperone protein - -

Protein Sequence

MRYWGKLLGLIIGSFAGIGFWGIVIGVFLGHLYDVQRSKLSYGGRYNRDRQAYFFAATFQVLGHLTKSKGRVTQTDITLASTLMDRMNLHGAARQAAQQAFREGKEVDFPLRATLQRVRQICAGRRDLLQMFLEIQLQAAFADGQLHPNERKMLFIIIDELGFSRARFEHILAMMQAGQSFHYQQGQNYQPQTQGPTLSDAYKVLGIKEGDDVKTIKRAYRKLMGEHHPDKLVAKGLPPEMMEIAKQKAQAIQVAYDLIKKEKGFR

Flanking regions ( +/- flanking 50bp)

AGTATGATAATGCAAAATTGTGAGCAGGGCATTGAAGATTTGAGGAGTCTATGCGCTATTGGGGAAAATTATTAGGCCTTATCATCGGTAGTTTTGCCGGGATCGGCTTTTGGGGCATTGTGATTGGGGTTTTTCTAGGACACCTTTATGACGTACAAAGAAGTAAATTAAGCTATGGTGGGCGCTATAATCGTGATAGACAAGCCTATTTCTTTGCTGCCACATTCCAAGTCTTAGGGCATTTAACCAAATCCAAAGGACGAGTGACACAAACCGATATCACATTAGCCAGTACGTTAATGGATAGAATGAATTTACATGGGGCAGCACGTCAAGCAGCACAACAGGCGTTTCGAGAAGGTAAAGAGGTTGATTTCCCACTTAGAGCCACCTTACAACGTGTTCGCCAAATTTGTGCCGGTCGCCGTGATTTACTGCAGATGTTTCTGGAAATTCAATTACAAGCCGCATTTGCTGATGGGCAGTTACATCCTAACGAACGTAAAATGCTGTTTATTATTATTGATGAGCTCGGATTTTCTCGCGCCCGTTTTGAACATATATTAGCCATGATGCAGGCGGGGCAAAGTTTTCATTATCAACAAGGGCAAAATTATCAGCCACAAACTCAAGGCCCAACGCTTTCTGACGCCTATAAAGTGTTAGGTATTAAAGAGGGGGATGATGTTAAAACAATAAAAAGAGCTTATCGAAAATTAATGGGAGAACATCATCCTGATAAATTGGTTGCAAAAGGTTTACCACCGGAGATGATGGAAATTGCAAAACAAAAAGCACAAGCTATCCAAGTTGCTTACGATTTGATTAAAAAAGAAAAAGGATTTCGTTAACATCTTGTAAATAAAGATGAGAAAAGAGAGAATTAATCCGTGATGAAGAT