Homologs in group_1114

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05920 FBDBKF_05920 55.8 Morganella morganii S1 rof Rho-binding antiterminator
EHELCC_08965 EHELCC_08965 55.8 Morganella morganii S2 rof Rho-binding antiterminator
NLDBIP_09345 NLDBIP_09345 55.8 Morganella morganii S4 rof Rho-binding antiterminator
LHKJJB_08410 LHKJJB_08410 55.8 Morganella morganii S3 rof Rho-binding antiterminator
HKOGLL_07960 HKOGLL_07960 55.8 Morganella morganii S5 rof Rho-binding antiterminator
F4V73_RS15975 F4V73_RS15975 53.5 Morganella psychrotolerans rof Rho-binding antiterminator

Distribution of the homologs in the orthogroup group_1114

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1114

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFW9 3.21e-26 95 55 0 80 3 rof Protein rof Shigella flexneri
P0AFW8 3.21e-26 95 55 0 80 1 rof Protein rof Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11190
Feature type CDS
Gene rof
Product Rho-binding antiterminator
Location 2461997 - 2462257 (strand: 1)
Length 261 (nucleotides) / 86 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1114
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07073 Modulator of Rho-dependent transcription termination (ROF)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4568 Transcription (K) K Transcriptional antiterminator Rof (Rho-off)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19000 Rho-binding antiterminator - -

Protein Sequence

MSTNTEYQPINCDDYEYLELACQRGLTLHIELHNGEQIDGVADDLFLSKKVEYLKVKTSEGAKDLRLDIIASFSHPELGTIIIKSE

Flanking regions ( +/- flanking 50bp)

CTGAATTATTCACTGGCGGCAATACCGCCACGAACGAGTGGTGAGGGAATATGTCAACAAATACAGAATATCAACCAATTAATTGTGATGATTATGAATATTTGGAGTTAGCTTGCCAACGAGGCTTAACACTCCATATTGAATTACATAATGGTGAGCAAATTGATGGTGTCGCAGATGATCTCTTTTTAAGTAAAAAAGTTGAATATCTGAAAGTAAAAACATCTGAGGGTGCAAAAGATTTACGACTGGATATTATTGCCAGTTTTTCTCATCCCGAACTTGGCACTATCATAATCAAATCTGAATAACTATTTACATAAACAACCGCCGTAATTGGCGGTTGTTTACGACGCTTGCC