Homologs in group_2356

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19015 FBDBKF_19015 83.3 Morganella morganii S1 queD 6-carboxytetrahydropterin synthase QueD
EHELCC_18760 EHELCC_18760 83.3 Morganella morganii S2 queD 6-carboxytetrahydropterin synthase QueD
NLDBIP_18545 NLDBIP_18545 83.3 Morganella morganii S4 queD 6-carboxytetrahydropterin synthase QueD
LHKJJB_18630 LHKJJB_18630 83.3 Morganella morganii S3 queD 6-carboxytetrahydropterin synthase QueD
HKOGLL_18365 HKOGLL_18365 83.3 Morganella morganii S5 queD 6-carboxytetrahydropterin synthase QueD
F4V73_RS13920 F4V73_RS13920 85.1 Morganella psychrotolerans queD 6-carboxytetrahydropterin synthase QueD

Distribution of the homologs in the orthogroup group_2356

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2356

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P65872 2.43e-75 221 84 0 121 3 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Shigella flexneri
P65870 2.43e-75 221 84 0 121 1 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Escherichia coli (strain K12)
P65871 2.43e-75 221 84 0 121 3 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Escherichia coli O157:H7
Q8K9D8 3.85e-60 183 64 0 119 3 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q55798 7.71e-27 99 45 4 119 3 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O31676 1.77e-15 70 35 4 124 1 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Bacillus subtilis (strain 168)
O29809 6.83e-13 63 37 4 101 3 queD Putative 6-carboxy-5,6,7,8-tetrahydropterin synthase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
E7FHF1 8.03e-11 58 32 2 90 1 PF1278 Dihydroneopterin monophosphate aldolase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q1ZXI0 9.09e-11 58 35 4 101 3 ptsA 6-pyruvoyl tetrahydrobiopterin synthase Dictyostelium discoideum
P44123 8.02e-10 55 30 7 141 3 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P48611 1.47e-08 53 32 5 104 1 pr 6-pyruvoyl tetrahydrobiopterin synthase Drosophila melanogaster
O27296 3.21e-08 52 32 1 74 3 queD Putative 6-carboxy-5,6,7,8-tetrahydropterin synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
O02058 5.05e-08 51 30 6 137 1 ptps-1 Putative 6-pyruvoyl tetrahydrobiopterin synthase Caenorhabditis elegans
Q03393 5.66e-07 48 31 4 97 1 PTS 6-pyruvoyl tetrahydrobiopterin synthase Homo sapiens
P27213 1.18e-06 47 34 5 102 1 Pts 6-pyruvoyl tetrahydrobiopterin synthase Rattus norvegicus
Q5REZ5 1.8e-06 47 30 4 97 2 PTS 6-pyruvoyl tetrahydrobiopterin synthase Pongo abelii
Q9R1Z7 3.35e-06 46 30 4 97 1 Pts 6-pyruvoyl tetrahydrobiopterin synthase Mus musculus
O66626 4.12e-06 46 26 6 158 3 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Aquifex aeolicus (strain VF5)
Q90W95 7.84e-06 45 29 4 97 2 pts 6-pyruvoyl tetrahydrobiopterin synthase Poecilia reticulata
B0R9W7 0.000806 40 29 6 116 3 queD Probable 6-carboxy-5,6,7,8-tetrahydropterin synthase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11090
Feature type CDS
Gene queD
Product 6-carboxytetrahydropterin synthase QueD
Location 2441827 - 2442192 (strand: 1)
Length 366 (nucleotides) / 121 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2356
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01242 6-pyruvoyl tetrahydropterin synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0720 Coenzyme transport and metabolism (H) H 6-pyruvoyl-tetrahydropterin synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01737 6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50] Folate biosynthesis
Metabolic pathways
Biosynthesis of cofactors		 Tetrahydrobiopterin biosynthesis, GTP => BH4
L-threo-Tetrahydrobiopterin biosynthesis, GTP => L-threo-BH4

Protein Sequence

MMITTIFKDFQFEAAHHLPHVPKGHKCGRLHGHSFLVRLEITGEVDAQSGWLIDFADVKAAFKPTLDRLDHYYLNDIEGLENPTSEVLAKWIWQQVKPSLPLLSAVMVKETCTAGCIYRGE

Flanking regions ( +/- flanking 50bp)

AATAGACACCGTTTTATCTGTATTTTTTTACTATTTAAGTCAAGAGAGTTTTGATGATAACCACCATCTTTAAAGATTTTCAGTTTGAAGCTGCGCACCACTTACCCCATGTTCCCAAAGGCCATAAATGTGGACGTTTACATGGGCATTCATTTTTAGTGAGATTAGAAATCACTGGTGAAGTAGATGCGCAGTCAGGTTGGCTAATTGATTTTGCTGATGTGAAAGCCGCATTTAAACCGACTCTTGATAGGCTCGACCACTATTATCTTAATGACATTGAAGGGTTAGAAAATCCAACCAGCGAAGTACTGGCAAAATGGATTTGGCAACAAGTTAAACCATCACTCCCCCTGTTATCCGCCGTGATGGTTAAAGAGACATGTACCGCAGGATGTATTTATCGTGGTGAGTAATTTTCACCTAAAAAAATCAGCCACTCATAGGCTGATTTTTTTTAACGATA