Homologs in group_1289

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07830 FBDBKF_07830 68.1 Morganella morganii S1 purT formate-dependent phosphoribosylglycinamide formyltransferase
EHELCC_13660 EHELCC_13660 68.1 Morganella morganii S2 purT formate-dependent phosphoribosylglycinamide formyltransferase
NLDBIP_14105 NLDBIP_14105 68.1 Morganella morganii S4 purT formate-dependent phosphoribosylglycinamide formyltransferase
LHKJJB_08745 LHKJJB_08745 68.1 Morganella morganii S3 purT formate-dependent phosphoribosylglycinamide formyltransferase
HKOGLL_08295 HKOGLL_08295 68.1 Morganella morganii S5 purT formate-dependent phosphoribosylglycinamide formyltransferase
F4V73_RS13215 F4V73_RS13215 69.9 Morganella psychrotolerans purT formate-dependent phosphoribosylglycinamide formyltransferase

Distribution of the homologs in the orthogroup group_1289

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1289

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1Q4 0.0 820 100 0 399 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Proteus mirabilis (strain HI4320)
A1JLK9 0.0 588 72 0 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q66BW5 0.0 579 72 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K0H3 0.0 579 72 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JP38 0.0 579 72 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TKC7 0.0 579 72 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Yersinia pestis (strain Pestoides F)
Q1CH54 0.0 579 72 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R5W9 0.0 579 72 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q7CHW4 0.0 579 72 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Yersinia pestis
Q1C8V8 0.0 579 72 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
Q3Z2K0 0.0 564 69 0 385 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shigella sonnei (strain Ss046)
P33221 0.0 564 69 0 385 1 purT Formate-dependent phosphoribosylglycinamide formyltransferase Escherichia coli (strain K12)
B1XHB7 0.0 564 69 0 385 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Escherichia coli (strain K12 / DH10B)
C4ZZK6 0.0 564 69 0 385 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
Q83KS0 0.0 563 69 0 385 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shigella flexneri
Q0T3V7 0.0 563 69 0 385 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shigella flexneri serotype 5b (strain 8401)
Q32HB3 0.0 563 69 0 385 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
A7MEA0 0.0 563 72 0 374 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
B2U494 0.0 562 69 0 385 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RAT6 0.0 561 69 0 385 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Escherichia coli (strain UTI89 / UPEC)
Q0TGY3 0.0 561 69 0 385 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AC10 0.0 561 69 0 385 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Escherichia coli O1:K1 / APEC
Q8XCJ9 0.0 560 69 0 385 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Escherichia coli O157:H7
Q322G6 0.0 559 68 0 385 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shigella boydii serotype 4 (strain Sb227)
B5XQ21 0.0 558 71 0 376 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Klebsiella pneumoniae (strain 342)
B4TYQ6 0.0 552 68 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Salmonella schwarzengrund (strain CVM19633)
C0Q2G8 0.0 551 68 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Salmonella paratyphi C (strain RKS4594)
Q57NB7 0.0 551 68 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Salmonella choleraesuis (strain SC-B67)
Q8Z5X3 0.0 550 68 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Salmonella typhi
B5BH72 0.0 550 68 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Salmonella paratyphi A (strain AKU_12601)
Q5PIA0 0.0 550 68 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SVD3 0.0 550 67 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Salmonella newport (strain SL254)
B5FSQ0 0.0 550 67 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Salmonella dublin (strain CT_02021853)
Q8ZNW5 0.0 549 68 0 382 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MUY8 0.0 548 67 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B2VJA4 0.0 546 68 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A9MNE8 0.0 545 65 0 392 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
C4LDC0 0.0 536 66 1 390 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A1S9F3 0.0 536 68 1 390 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q2NTH8 0.0 535 67 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Sodalis glossinidius (strain morsitans)
C6DFT2 0.0 535 69 0 382 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4B6 0.0 533 68 0 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q07YK6 0.0 528 67 1 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shewanella frigidimarina (strain NCIMB 400)
Q5E4R4 0.0 527 65 1 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1RMT4 0.0 525 68 1 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shewanella sp. (strain W3-18-1)
A7MVH5 0.0 521 65 1 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Vibrio campbellii (strain ATCC BAA-1116)
A3D1A0 0.0 521 68 1 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A0L052 0.0 521 68 1 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shewanella sp. (strain ANA-3)
A4Y447 0.0 521 68 1 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EBB7 0.0 520 68 1 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q87Q53 0.0 518 63 1 387 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q0HS20 0.0 518 68 1 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shewanella sp. (strain MR-7)
A6WK72 0.0 518 68 1 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shewanella baltica (strain OS185)
Q0HFS6 0.0 518 68 1 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Shewanella sp. (strain MR-4)
A1SWW0 0.0 517 63 1 383 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
C5BGW0 0.0 516 65 0 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Edwardsiella ictaluri (strain 93-146)
C3LLS4 0.0 514 63 1 392 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KSM8 0.0 511 63 1 390 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6LRI4 1.13e-179 508 64 1 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Photobacterium profundum (strain SS9)
Q48LW5 2.26e-179 507 63 1 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A0KK42 2.33e-179 507 64 1 382 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C3K1H6 1.62e-178 505 63 1 390 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pseudomonas fluorescens (strain SBW25)
Q4ZWZ4 2.45e-178 504 63 1 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pseudomonas syringae pv. syringae (strain B728a)
A1U3I4 3.3e-178 504 61 1 386 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B0KRH6 5.5e-178 504 63 1 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pseudomonas putida (strain GB-1)
Q88MW1 7.97e-178 503 63 1 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q31DQ3 9.82e-178 503 63 1 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3KHJ9 1.21e-177 503 62 1 390 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q7MK47 1.33e-177 503 62 1 387 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Vibrio vulnificus (strain YJ016)
Q8DA32 1.33e-177 503 62 1 387 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Vibrio vulnificus (strain CMCP6)
Q1I5Y3 4.25e-177 501 62 1 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pseudomonas entomophila (strain L48)
Q886V7 7.18e-177 501 62 1 390 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q30XN3 9.75e-177 500 62 1 382 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A4SMX4 3.69e-176 499 65 1 370 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Aeromonas salmonicida (strain A449)
B1JDF0 4.66e-176 499 64 1 376 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pseudomonas putida (strain W619)
Q0I203 5.22e-175 496 63 1 383 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Histophilus somni (strain 129Pt)
C1DDZ2 1.02e-174 495 62 1 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4KHR3 1.29e-174 495 64 1 376 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q65VI3 5.72e-174 493 62 1 382 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B3GXZ2 7.52e-174 493 61 1 382 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N1B2 7.52e-174 493 61 1 382 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q9HXP3 8.29e-174 493 64 1 375 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02RM4 8.29e-174 493 64 1 375 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UYK0 8.29e-174 493 64 1 375 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pseudomonas aeruginosa (strain LESB58)
B0BQ46 1.11e-173 493 61 1 382 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A4VIT1 1.31e-171 488 61 1 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Stutzerimonas stutzeri (strain A1501)
Q8PBI2 1.22e-170 485 60 2 394 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RY47 1.22e-170 485 60 2 394 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q4US21 1.22e-170 485 60 2 394 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Xanthomonas campestris pv. campestris (strain 8004)
A1K4Y1 2.64e-170 484 63 1 376 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Azoarcus sp. (strain BH72)
C6BV99 4.42e-170 484 60 1 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q7VNI4 5.26e-170 483 62 1 379 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q5GWZ8 2.27e-169 482 60 4 395 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P047 2.27e-169 482 60 4 395 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q2SJZ8 3.01e-169 482 60 1 396 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Hahella chejuensis (strain KCTC 2396)
Q3BW63 3.7e-169 481 60 2 394 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B2SRI5 1.17e-168 480 60 4 395 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
C4XMB3 1.2e-168 480 65 1 370 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q9CLZ5 2.12e-168 479 61 1 383 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pasteurella multocida (strain Pm70)
Q8PN36 1.57e-167 478 59 2 394 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Xanthomonas axonopodis pv. citri (strain 306)
B2FTB9 3.81e-167 476 60 3 390 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Stenotrophomonas maltophilia (strain K279a)
Q8D2R3 1.75e-166 474 55 2 390 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Wigglesworthia glossinidia brevipalpis
B4SP00 1.86e-166 474 61 3 376 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Stenotrophomonas maltophilia (strain R551-3)
Q0VRD0 2.09e-165 472 60 2 387 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1VFP6 6.32e-164 468 61 1 375 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Nitratidesulfovibrio vulgaris (strain DP4)
Q72E56 6.32e-164 468 61 1 375 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B8DJ34 1.97e-163 467 60 1 376 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A6LHW2 1.84e-160 459 58 1 384 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q3A5Q4 6e-158 453 56 1 387 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
P46927 3.22e-157 451 61 2 380 1 purT Formate-dependent phosphoribosylglycinamide formyltransferase Mannheimia haemolytica
P39771 1.05e-155 447 58 1 373 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Bacillus subtilis (strain 168)
Q7WEY0 1.49e-155 447 59 7 400 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W006 2.35e-155 447 59 7 395 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q2KUD7 5.34e-155 446 59 7 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Bordetella avium (strain 197N)
Q7W3K5 2.97e-154 444 58 7 400 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q47A50 3.38e-154 444 59 7 395 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Dechloromonas aromatica (strain RCB)
Q39QR8 1.11e-153 442 55 1 387 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q0BP50 3.53e-153 441 57 1 369 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5V8 3.53e-153 441 57 1 369 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Francisella tularensis subsp. holarctica (strain LVS)
A7N9C6 3.53e-153 441 57 1 369 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A0Q8N2 5.17e-153 440 57 1 369 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Francisella tularensis subsp. novicida (strain U112)
A4IVS8 7.74e-153 439 57 1 369 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NE84 1.03e-152 439 56 1 375 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14FN7 1.03e-152 439 56 1 375 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Francisella tularensis subsp. tularensis (strain FSC 198)
A7Z0Z2 6.35e-151 435 57 1 365 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A1ANT6 8.4e-150 432 56 1 386 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A4G4X3 1.22e-149 432 58 5 379 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Herminiimonas arsenicoxydans
Q58881 7e-148 427 55 3 386 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q606K7 1.15e-147 427 57 5 393 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8NM23 3.25e-147 426 53 4 400 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QHG1 3.25e-147 426 53 4 400 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Corynebacterium glutamicum (strain R)
Q1LMC7 1.84e-146 424 56 7 395 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q0BD59 1.95e-146 424 57 5 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A4JGK4 2.18e-146 424 59 5 375 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
B1Y650 5.11e-146 423 55 8 406 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q39E61 8.06e-146 422 57 5 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
C5CP83 1.19e-145 422 58 7 381 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Variovorax paradoxus (strain S110)
Q1BUU4 2.51e-145 421 57 5 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia orbicola (strain AU 1054)
A0K993 2.51e-145 421 57 5 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia cenocepacia (strain HI2424)
Q142Q7 5.09e-145 421 55 5 394 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Paraburkholderia xenovorans (strain LB400)
A6UUH1 9.62e-145 419 52 2 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q2SZW6 1.34e-144 419 58 4 374 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q6FAM6 1.95e-144 419 55 4 393 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B1MKI7 9.24e-144 417 55 6 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A6SZI7 1.08e-143 417 58 5 378 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Janthinobacterium sp. (strain Marseille)
A3M4Q9 1.18e-143 417 56 4 378 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q1H1W4 1.66e-143 416 56 6 399 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B8GRA4 2.48e-143 416 56 6 384 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
B3R259 5.71e-143 415 55 7 398 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A1VT89 5.96e-143 415 56 7 397 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Polaromonas naphthalenivorans (strain CJ2)
A9BNI6 7.53e-143 415 56 8 400 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q12FU8 8.93e-143 415 55 7 397 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q0SEI4 1.04e-142 414 54 4 392 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Rhodococcus jostii (strain RHA1)
Q3SKP9 1.47e-142 414 57 5 378 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Thiobacillus denitrificans (strain ATCC 25259)
Q470L8 2.21e-142 414 55 7 397 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q6M0Z5 3.74e-142 412 53 1 380 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A3N7B6 4.08e-142 413 58 4 374 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia pseudomallei (strain 668)
Q21SJ0 5.26e-142 413 56 11 405 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A0R2Y2 7.15e-142 412 55 7 386 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q63VY4 8.94e-142 412 58 4 374 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia pseudomallei (strain K96243)
Q3JUJ4 8.94e-142 412 58 4 374 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia pseudomallei (strain 1710b)
A3NT04 8.94e-142 412 58 4 374 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia pseudomallei (strain 1106a)
A6URA6 9.76e-142 411 52 1 386 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
A4G068 1.28e-141 411 53 1 386 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A1V2C2 1.51e-141 412 58 4 374 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia mallei (strain SAVP1)
Q62IF4 1.51e-141 412 58 4 374 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia mallei (strain ATCC 23344)
A2S4F3 1.51e-141 412 58 4 374 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia mallei (strain NCTC 10229)
A3MI07 1.51e-141 412 58 4 374 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Burkholderia mallei (strain NCTC 10247)
A4T9D5 1.64e-141 411 53 6 397 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Mycolicibacterium gilvum (strain PYR-GCK)
A6VIB2 3.46e-141 410 53 1 386 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Q8FMB3 3.84e-141 410 54 4 382 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q0KAH8 1.05e-140 409 55 8 400 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A1TV10 3.29e-139 406 55 9 405 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Paracidovorax citrulli (strain AAC00-1)
A1TE53 5.53e-139 405 54 7 390 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q30UL7 4.07e-132 387 52 3 379 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q55336 9.24e-132 386 51 2 378 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q3AUF2 3.13e-131 385 50 2 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Synechococcus sp. (strain CC9902)
Q3M8Q4 4.08e-129 379 52 2 377 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A6Q186 5.46e-129 379 51 2 375 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Nitratiruptor sp. (strain SB155-2)
Q0I600 2.54e-128 377 51 2 383 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Synechococcus sp. (strain CC9311)
Q7M8I0 6.46e-128 376 51 2 377 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q46KI4 7.74e-127 374 49 4 379 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Prochlorococcus marinus (strain NATL2A)
A2BWY5 3.09e-126 372 47 2 377 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Prochlorococcus marinus (strain MIT 9515)
A2C2S8 4.32e-126 372 49 4 379 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Prochlorococcus marinus (strain NATL1A)
Q8YXB6 4.88e-126 372 51 2 377 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A5GPT7 9.12e-125 368 50 2 389 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Synechococcus sp. (strain WH7803)
Q18K60 1.58e-124 368 51 1 390 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q2N8K3 9.07e-124 366 50 1 388 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Erythrobacter litoralis (strain HTCC2594)
A6Q6K6 2.16e-123 365 49 3 384 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Sulfurovum sp. (strain NBC37-1)
A6GWP9 3.45e-123 364 50 4 370 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q7VBB3 3.99e-123 364 49 2 383 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q5N3J5 4.9e-123 364 53 2 364 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31QP9 4.9e-123 364 53 2 364 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8EYF0 7.32e-123 363 50 3 361 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72LY0 7.32e-123 363 50 3 361 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8KDJ0 1.31e-122 363 51 3 357 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A2CE36 1.77e-122 363 52 2 366 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Prochlorococcus marinus (strain MIT 9303)
Q7U3B3 2.27e-122 362 51 2 369 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Parasynechococcus marenigrum (strain WH8102)
A3PD91 7.69e-122 361 46 2 377 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Prochlorococcus marinus (strain MIT 9301)
Q7V179 1.09e-121 360 46 2 377 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q31AM1 1.74e-121 360 46 2 377 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Prochlorococcus marinus (strain MIT 9312)
A1BHN0 2.93e-121 359 50 3 360 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A2BRG6 3.77e-121 359 46 2 377 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Prochlorococcus marinus (strain AS9601)
Q2IJJ5 1.65e-120 357 51 5 375 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q056L2 1.78e-120 357 49 3 361 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04P21 1.78e-120 357 49 3 361 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q7V3S4 2.24e-120 357 51 2 366 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Prochlorococcus marinus (strain MIT 9313)
Q3AG69 2.24e-120 357 52 2 358 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Synechococcus sp. (strain CC9605)
Q4JXR6 1.88e-115 345 47 5 394 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Corynebacterium jeikeium (strain K411)
A5GX22 4.86e-115 343 49 3 368 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Synechococcus sp. (strain RCC307)
Q8U3M7 5.8e-114 342 46 4 401 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9UY67 3.29e-113 340 46 4 401 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pyrococcus abyssi (strain GE5 / Orsay)
A8ACE0 5.29e-113 339 46 5 391 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
O58056 3.08e-112 338 45 4 401 1 purT Formate-dependent phosphoribosylglycinamide formyltransferase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q981B9 5.66e-112 336 44 4 393 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q8A9W1 2.09e-111 334 49 5 363 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A6L404 7.13e-110 330 49 5 363 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q5LD90 7.21e-110 330 49 5 363 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q5JFN8 9.46e-110 332 45 4 401 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q8G5B0 1.23e-109 330 46 5 394 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Bifidobacterium longum (strain NCC 2705)
A1A0S3 1.6e-109 330 47 6 376 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Q64UB2 3.26e-109 328 49 5 363 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Bacteroides fragilis (strain YCH46)
Q96Y60 1.78e-106 322 45 4 394 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q4JC46 1.94e-103 314 44 4 397 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q0W4L8 2.97e-100 307 44 10 397 3 purT Formate-dependent phosphoribosylglycinamide formyltransferase Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
P50504 1.04e-27 118 27 9 304 3 ADE2 Phosphoribosylaminoimidazole carboxylase Schwanniomyces occidentalis
P15567 1.39e-27 117 25 12 370 3 ade6 Phosphoribosylaminoimidazole carboxylase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q01930 1.6e-27 117 27 8 309 3 ADE1 Phosphoribosylaminoimidazole carboxylase Ogataea methanolica
P21264 4.65e-25 110 25 7 308 1 ADE2 Phosphoribosylaminoimidazole carboxylase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O74197 8.22e-25 109 25 9 312 1 ADE2 Phosphoribosylaminoimidazole carboxylase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q92210 3.35e-22 102 25 10 322 3 ADE2 Phosphoribosylaminoimidazole carboxylase Candida albicans (strain SC5314 / ATCC MYA-2876)
P12045 9.15e-22 99 23 7 347 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Bacillus subtilis (strain 168)
Q54QE4 1.46e-21 100 25 10 367 1 purC/E Bifunctional purine synthesis protein purC/E Dictyostelium discoideum
Q5E1R3 2.01e-21 98 25 10 363 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
P43850 1.73e-20 95 29 12 306 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0C017 2.97e-20 96 24 12 375 2 ADE2 Phosphoribosylaminoimidazole carboxylase Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
P0CQ37 3.29e-19 93 24 12 378 3 ADE2 Phosphoribosylaminoimidazole carboxylase Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q8NX94 6.16e-19 90 26 11 299 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Staphylococcus aureus (strain MW2)
Q6GAE8 6.16e-19 90 26 11 299 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Staphylococcus aureus (strain MSSA476)
Q7A695 6.21e-19 90 26 11 299 1 purK N5-carboxyaminoimidazole ribonucleotide synthase Staphylococcus aureus (strain N315)
Q99V32 6.21e-19 90 26 11 299 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH19 6.58e-19 90 26 11 299 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Staphylococcus aureus (strain COL)
Q6GI19 1.03e-18 90 27 11 299 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Staphylococcus aureus (strain MRSA252)
P55195 1.1e-18 91 27 10 294 2 PURKE Phosphoribosylaminoimidazole carboxylase, chloroplastic (Fragment) Vigna aconitifolia
P0CQ36 1.41e-18 91 24 12 378 3 ADE2 Phosphoribosylaminoimidazole carboxylase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P72158 3.84e-18 88 26 8 311 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52559 5.01e-18 88 24 9 353 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q9KVT8 1.5e-17 87 26 8 319 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O06457 5.51e-17 85 24 14 371 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q4L574 2.2e-16 83 24 14 352 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Staphylococcus haemolyticus (strain JCSC1435)
Q54975 3.38e-16 83 25 7 379 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8CPP2 3.27e-15 80 22 8 358 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQA5 3.3e-15 80 22 8 358 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O66608 3.47e-15 79 25 12 351 1 purK N5-carboxyaminoimidazole ribonucleotide synthase Aquifex aeolicus (strain VF5)
Q87KE0 4.67e-15 79 22 11 367 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8DDD8 9.26e-15 78 23 9 347 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Vibrio vulnificus (strain CMCP6)
Q7MGL1 1.12e-14 78 23 9 347 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Vibrio vulnificus (strain YJ016)
P9WHL9 4.06e-14 77 25 11 351 1 purK N5-carboxyaminoimidazole ribonucleotide synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHL8 4.06e-14 77 25 11 351 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65899 4.06e-14 77 25 11 351 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q49WI9 1.3e-13 75 22 8 298 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P09029 1.61e-12 71 28 4 193 1 purK N5-carboxyaminoimidazole ribonucleotide synthase Escherichia coli (strain K12)
P74724 4.54e-09 61 23 13 385 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P46701 9.06e-09 60 25 7 313 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Mycobacterium leprae (strain TN)
Q42523 3.24e-08 59 23 11 323 1 MCCA Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Arabidopsis thaliana
Q38X24 2.08e-07 57 25 10 239 3 carB Carbamoyl phosphate synthase large chain Latilactobacillus sakei subsp. sakei (strain 23K)
Q44678 1.05e-06 53 28 4 164 3 purK N5-carboxyaminoimidazole ribonucleotide synthase Corynebacterium ammoniagenes
Q54KE6 3.41e-06 52 28 8 184 3 mccA Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Dictyostelium discoideum
A5UKG5 6.08e-06 52 23 12 304 3 carB Carbamoyl phosphate synthase large chain Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
A0LQR5 1.25e-05 50 27 6 155 3 ddl D-alanine--D-alanine ligase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B8GEA3 1.62e-05 50 24 4 186 3 carB Carbamoyl phosphate synthase large chain Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
B2GD06 1.73e-05 50 24 20 435 3 carB Carbamoyl phosphate synthase large chain Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q2FLD9 2.4e-05 50 23 10 298 3 carB Carbamoyl phosphate synthase large chain Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q1AVY9 3.23e-05 50 21 5 232 3 carB Carbamoyl phosphate synthase large chain Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1AVY9 0.000195 47 24 10 244 3 carB Carbamoyl phosphate synthase large chain Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
B9DRV7 3.23e-05 50 24 6 187 3 carB Carbamoyl phosphate synthase large chain Streptococcus uberis (strain ATCC BAA-854 / 0140J)
O67233 3.89e-05 49 24 9 275 3 carB2 Carbamoyl phosphate synthase large chain, C-terminal section Aquifex aeolicus (strain VF5)
Q9KWU4 4.48e-05 49 22 10 297 1 pyc Pyruvate carboxylase Bacillus subtilis (strain 168)
P63740 4.81e-05 49 24 15 329 1 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain N315)
P63739 4.81e-05 49 24 15 329 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IS88 4.81e-05 49 24 15 329 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain JH9)
A6U122 4.81e-05 49 24 15 329 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain JH1)
A7X1F4 4.81e-05 49 24 15 329 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GHN2 5.11e-05 49 24 15 329 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain MRSA252)
B8D1H3 5.64e-05 49 25 11 278 3 carB Carbamoyl phosphate synthase large chain Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A8Z3P0 5.73e-05 49 24 15 329 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain USA300 / TCH1516)
Q6GA10 5.73e-05 49 24 15 329 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain MSSA476)
A6QGA4 5.73e-05 49 24 15 329 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain Newman)
Q5HGM9 5.73e-05 49 24 15 329 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain COL)
Q2FZ72 5.73e-05 49 24 15 329 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHN5 5.73e-05 49 24 15 329 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain USA300)
A7Z1L3 7.19e-05 48 25 6 160 3 ddl D-alanine--D-alanine ligase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q9RLS9 7.25e-05 48 25 9 235 3 carB1 Carbamoyl phosphate synthase arginine-specific large chain Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P58942 9.11e-05 48 24 13 307 3 carB Carbamoyl phosphate synthase large chain Xanthomonas axonopodis pv. citri (strain 306)
C4ZEK2 0.000132 48 25 13 281 3 carB Carbamoyl phosphate synthase large chain Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
P05990 0.000133 48 24 6 242 1 r Multifunctional protein r Drosophila melanogaster
A0A0H3JRU9 0.00014 47 26 3 147 1 pycA Pyruvate carboxylase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q9PIL7 0.000141 47 24 14 305 3 carB Carbamoyl phosphate synthase large chain Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8AX83 0.00018 47 25 15 323 3 carB Carbamoyl phosphate synthase large chain Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
P18185 0.000185 47 30 3 123 3 carB Carbamoyl phosphate synthase arginine-specific large chain Bacillus subtilis (strain 168)
Q88DU6 0.000202 47 22 11 305 3 carB Carbamoyl phosphate synthase large chain Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2YXG5 0.00021 47 24 15 329 3 carB Carbamoyl phosphate synthase large chain Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q55756 0.000221 47 22 9 300 3 carB Carbamoyl phosphate synthase large chain Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A6LPD9 0.000222 47 22 16 397 3 carB Carbamoyl phosphate synthase large chain Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
P58943 0.000245 47 24 13 307 3 carB Carbamoyl phosphate synthase large chain Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q91293 0.000301 47 24 8 210 2 None Carbamoyl-phosphate synthase [ammonia], mitochondrial Aquarana catesbeiana
A3CNI5 0.000414 46 25 7 187 3 carB Carbamoyl phosphate synthase large chain Streptococcus sanguinis (strain SK36)
P25994 0.000426 46 23 13 316 1 pyrAB Carbamoyl phosphate synthase pyrimidine-specific large chain Bacillus subtilis (strain 168)
B9EB69 0.000448 46 24 10 260 3 carB Carbamoyl phosphate synthase large chain Macrococcus caseolyticus (strain JCSC5402)
Q87WP4 0.000465 46 23 4 186 3 carB Carbamoyl phosphate synthase large chain Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A1R7J5 0.000518 45 25 7 200 3 ddl D-alanine--D-alanine ligase Paenarthrobacter aurescens (strain TC1)
Q8DUP3 0.000519 46 24 16 327 3 carB Carbamoyl phosphate synthase large chain Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P07756 0.000523 46 23 6 207 1 Cps1 Carbamoyl-phosphate synthase [ammonia], mitochondrial Rattus norvegicus
C1CR31 0.000591 45 24 14 320 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae (strain Taiwan19F-14)
Q97QE4 0.000591 45 24 14 320 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04K48 0.000591 45 24 14 320 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
O50302 0.000591 45 25 4 148 3 pyrAB Carbamoyl phosphate synthase pyrimidine-specific large chain Geobacillus stearothermophilus
B2IQ67 0.000622 45 24 14 320 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae (strain CGSP14)
B8ZJT9 0.000622 45 24 14 320 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
P96612 0.000626 45 27 6 151 3 ddl D-alanine--D-alanine ligase Bacillus subtilis (strain 168)
B5E512 0.000644 45 24 14 320 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae serotype 19F (strain G54)
Q5HPY8 0.00065 45 22 13 330 3 carB Carbamoyl phosphate synthase large chain Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8DZQ7 0.00065 45 23 8 237 3 carB Carbamoyl phosphate synthase large chain Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K150 0.000656 45 23 8 237 3 carB Carbamoyl phosphate synthase large chain Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A7GRL1 0.000663 45 23 12 312 3 carB Carbamoyl phosphate synthase large chain Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B5XKW2 0.000667 45 25 5 185 3 carB Carbamoyl phosphate synthase large chain Streptococcus pyogenes serotype M49 (strain NZ131)
Q8CWR0 0.000673 45 24 14 320 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B1IC65 0.000673 45 24 14 320 3 carB Carbamoyl phosphate synthase large chain Streptococcus pneumoniae (strain Hungary19A-6)
Q8E5F5 0.000697 45 23 8 237 3 carB Carbamoyl phosphate synthase large chain Streptococcus agalactiae serotype III (strain NEM316)
Q06862 0.000737 45 22 10 295 3 accC Biotin carboxylase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8C196 0.000739 45 22 6 207 1 Cps1 Carbamoyl-phosphate synthase [ammonia], mitochondrial Mus musculus
Q1D6Y8 0.000762 45 25 13 312 3 carB Carbamoyl phosphate synthase large chain Myxococcus xanthus (strain DK1622)
Q8CPJ4 0.000766 45 22 13 330 3 carB Carbamoyl phosphate synthase large chain Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A7GKE0 0.000838 45 24 5 159 3 ddl D-alanine--D-alanine ligase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A3CU73 0.000864 45 24 6 184 3 carB Carbamoyl phosphate synthase large chain Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
B9KFX8 0.000899 44 22 7 194 3 ddl D-alanine--D-alanine ligase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q9HP43 0.001 45 22 3 148 3 carB Carbamoyl phosphate synthase large chain Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10775
Feature type CDS
Gene purT
Product formate-dependent phosphoribosylglycinamide formyltransferase
Location 2372669 - 2373868 (strand: -1)
Length 1200 (nucleotides) / 399 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1289
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02222 ATP-grasp domain
PF21244 PurT, C-terminal
PF22660 Ribonucleotide synthetase preATP-grasp domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0027 Nucleotide transport and metabolism (F) F Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08289 phosphoribosylglycinamide formyltransferase 2 [EC:6.3.1.21] Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites		 De novo purine biosynthesis, PRPP + glutamine => IMP

Protein Sequence

MTILGTALTTNATKVMLLGAGELGKEVIIECQRLGIETIAVDRYANAPAMHVAHRHYVVNMLDSEALKQIITQEKPDFLVPEIEAIATSLLVELENNGQKVVPCARAVKLTMDREGIRRLAAETLHLLTSPYQFVDDEAAFRKAAVEIGFPCIVKPVMSSSGKGQSVIRSEQDLTSAWTYSQEGGRAGQGRVIVEKMIPFDFEITLLTIRAIDGIHFCEPIGHRQEKGDYRASWQPQKMSDIALAKAQHIASKVVENLGGYGLFGVELFIQGDEVFFNEVSPRPHDTGLVTLISQDLSEFALHVRAFLGYPIGGIRQLGACASAVILPELSSTNIVYTGLEKALKANRQIRLFAKPEIAGHRRLGVVLAHADSIKHAIEEANLGAQAILAHDGDNHLSR

Flanking regions ( +/- flanking 50bp)

ATGCAAACGTTTGCGTAATGCGTATTATCTGACTGAGATAAGGATCGAAAATGACCATTTTGGGAACGGCTCTGACCACTAATGCCACAAAAGTGATGTTATTAGGTGCAGGCGAATTAGGTAAAGAGGTGATCATTGAATGCCAACGTCTTGGCATTGAGACTATTGCGGTTGATCGCTATGCCAATGCGCCGGCAATGCATGTTGCTCATCGCCATTATGTCGTCAATATGCTTGATAGCGAGGCATTAAAACAGATTATAACTCAAGAAAAACCCGATTTTTTGGTGCCTGAAATTGAAGCTATTGCTACTTCATTATTAGTCGAATTAGAAAATAATGGTCAAAAAGTTGTACCTTGTGCCCGTGCAGTAAAACTCACTATGGATAGGGAAGGAATACGCCGTCTCGCTGCAGAAACATTACACTTACTGACTTCTCCTTATCAATTTGTTGATGATGAAGCGGCTTTTAGAAAAGCGGCGGTTGAGATTGGTTTTCCTTGCATTGTAAAACCGGTGATGAGCTCATCTGGAAAAGGACAAAGTGTTATTCGTTCAGAGCAAGATCTCACTAGTGCATGGACTTATTCTCAAGAAGGGGGAAGAGCAGGGCAAGGGCGCGTGATTGTTGAAAAGATGATCCCGTTTGATTTTGAGATAACATTACTCACGATTCGTGCTATTGATGGTATTCATTTTTGCGAGCCTATTGGTCATCGGCAAGAAAAAGGCGATTATCGTGCGTCATGGCAACCACAAAAAATGAGTGATATTGCCCTTGCCAAAGCACAACATATCGCCAGTAAAGTAGTGGAGAATTTGGGCGGTTATGGGTTATTTGGTGTGGAACTATTTATCCAAGGTGATGAGGTGTTTTTTAATGAAGTATCACCGCGTCCTCATGATACAGGGCTTGTTACCTTAATTTCACAAGATTTATCAGAATTTGCGCTCCATGTGCGTGCTTTTTTAGGCTATCCCATCGGTGGTATTCGCCAATTAGGTGCTTGTGCTTCCGCGGTGATTTTACCTGAGTTGTCTAGTACTAATATTGTCTATACGGGGTTAGAAAAAGCGCTTAAGGCAAATCGACAAATTCGTTTATTTGCTAAACCTGAAATCGCAGGACATCGTCGTTTAGGCGTGGTGCTTGCTCATGCCGATTCCATAAAACATGCTATTGAAGAGGCGAATTTAGGTGCACAAGCGATTTTAGCCCATGATGGTGATAACCATTTATCGCGGTGATCTACATACCGCCAATGGCTTTATATCATGCTTGCCTTTATGGCATTTCA