Homologs in group_981

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04930 FBDBKF_04930 88.2 Morganella morganii S1 folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
EHELCC_06220 EHELCC_06220 88.2 Morganella morganii S2 folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
NLDBIP_06540 NLDBIP_06540 88.2 Morganella morganii S4 folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
LHKJJB_03420 LHKJJB_03420 88.2 Morganella morganii S3 folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
HKOGLL_06895 HKOGLL_06895 88.2 Morganella morganii S5 folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
F4V73_RS16070 F4V73_RS16070 87.8 Morganella psychrotolerans folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD

Distribution of the homologs in the orthogroup group_981

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_981

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1G5 0.0 590 100 0 290 3 folD Bifunctional protein FolD Proteus mirabilis (strain HI4320)
Q7MZH1 0.0 515 87 0 284 3 folD Bifunctional protein FolD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A9MLA4 0.0 504 84 0 285 3 folD Bifunctional protein FolD Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P58688 0.0 503 85 0 285 3 folD Bifunctional protein FolD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TN64 0.0 503 85 0 285 3 folD Bifunctional protein FolD Salmonella schwarzengrund (strain CVM19633)
B5BCZ5 0.0 503 85 0 285 3 folD Bifunctional protein FolD Salmonella paratyphi A (strain AKU_12601)
C0PVJ3 0.0 503 85 0 285 3 folD Bifunctional protein FolD Salmonella paratyphi C (strain RKS4594)
A9MW26 0.0 503 85 0 285 3 folD Bifunctional protein FolD Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PCE5 0.0 503 85 0 285 3 folD Bifunctional protein FolD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SXP7 0.0 503 85 0 285 3 folD Bifunctional protein FolD Salmonella newport (strain SL254)
B4TA94 0.0 503 85 0 285 3 folD Bifunctional protein FolD Salmonella heidelberg (strain SL476)
B5R6X5 0.0 503 85 0 285 3 folD Bifunctional protein FolD Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5FLQ2 0.0 503 85 0 285 3 folD Bifunctional protein FolD Salmonella dublin (strain CT_02021853)
Q57S24 0.0 503 85 0 285 3 folD Bifunctional protein FolD Salmonella choleraesuis (strain SC-B67)
B5EYE2 0.0 503 85 0 285 3 folD Bifunctional protein FolD Salmonella agona (strain SL483)
B5QUV5 0.0 503 84 0 285 3 folD Bifunctional protein FolD Salmonella enteritidis PT4 (strain P125109)
Q60006 1.81e-180 501 84 0 285 3 folD Bifunctional protein FolD Salmonella typhi
A8AJS4 2e-180 501 84 0 285 3 folD Bifunctional protein FolD Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A1JNX2 3.85e-180 500 84 0 284 3 folD Bifunctional protein FolD Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P24186 4.76e-180 500 84 0 285 1 folD Bifunctional protein FolD Escherichia coli (strain K12)
B1IZ72 4.76e-180 500 84 0 285 3 folD Bifunctional protein FolD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XGC7 4.76e-180 500 84 0 285 3 folD Bifunctional protein FolD Escherichia coli (strain K12 / DH10B)
C4ZUX7 4.76e-180 500 84 0 285 3 folD Bifunctional protein FolD Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4N2 4.76e-180 500 84 0 285 3 folD Bifunctional protein FolD Escherichia coli O8 (strain IAI1)
B1LKE8 4.86e-180 500 84 0 285 3 folD Bifunctional protein FolD Escherichia coli (strain SMS-3-5 / SECEC)
B7N983 4.86e-180 500 84 0 285 3 folD Bifunctional protein FolD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NL23 4.86e-180 500 84 0 285 3 folD Bifunctional protein FolD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A6T5R4 6.33e-180 499 84 0 284 3 folD Bifunctional protein FolD Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y0K4 6.33e-180 499 84 0 284 3 folD Bifunctional protein FolD Klebsiella pneumoniae (strain 342)
B1JHI9 8.51e-180 499 84 0 284 3 folD Bifunctional protein FolD Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DK7 8.51e-180 499 84 0 284 3 folD Bifunctional protein FolD Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TP60 8.51e-180 499 84 0 284 3 folD Bifunctional protein FolD Yersinia pestis (strain Pestoides F)
Q1CKX8 8.51e-180 499 84 0 284 3 folD Bifunctional protein FolD Yersinia pestis bv. Antiqua (strain Nepal516)
A9R256 8.51e-180 499 84 0 284 3 folD Bifunctional protein FolD Yersinia pestis bv. Antiqua (strain Angola)
Q7CJY7 8.51e-180 499 84 0 284 3 folD Bifunctional protein FolD Yersinia pestis
B2K7N4 8.51e-180 499 84 0 284 3 folD Bifunctional protein FolD Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C4U4 8.51e-180 499 84 0 284 3 folD Bifunctional protein FolD Yersinia pestis bv. Antiqua (strain Antiqua)
A7FL44 8.51e-180 499 84 0 284 3 folD Bifunctional protein FolD Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GAY2 1.13e-179 499 84 0 284 3 folD Bifunctional protein FolD Serratia proteamaculans (strain 568)
Q3Z4P8 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Shigella sonnei (strain Ss046)
Q83SC8 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Shigella flexneri
Q0T773 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Shigella flexneri serotype 5b (strain 8401)
Q324Y6 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Shigella boydii serotype 4 (strain Sb227)
B2TTB0 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RF04 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Escherichia coli (strain UTI89 / UPEC)
Q8FK41 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKB2 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8J4 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Escherichia coli O1:K1 / APEC
A7ZXI3 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Escherichia coli O9:H4 (strain HS)
B7MRJ2 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Escherichia coli O81 (strain ED1a)
B5YPP4 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCT6 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Escherichia coli O157:H7
B7ME52 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UKK6 2.04e-179 498 84 0 285 3 folD Bifunctional protein FolD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B6I0H4 2.07e-179 498 84 0 285 3 folD Bifunctional protein FolD Escherichia coli (strain SE11)
B7L7F6 2.07e-179 498 84 0 285 3 folD Bifunctional protein FolD Escherichia coli (strain 55989 / EAEC)
A7ZIT8 2.07e-179 498 84 0 285 3 folD Bifunctional protein FolD Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LJI7 5.08e-179 498 83 0 285 3 folD Bifunctional protein FolD Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q32JK7 1.64e-178 496 83 0 285 3 folD Bifunctional protein FolD Shigella dysenteriae serotype 1 (strain Sd197)
A4W7J0 4.21e-177 493 83 0 284 3 folD Bifunctional protein FolD Enterobacter sp. (strain 638)
A7MJZ6 7.37e-177 492 83 0 284 3 folD Bifunctional protein FolD Cronobacter sakazakii (strain ATCC BAA-894)
C6DAX0 2.24e-172 481 80 0 284 3 folD Bifunctional protein FolD Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D2E6 4.32e-172 480 80 0 284 3 folD Bifunctional protein FolD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C5B8V3 9.13e-170 474 77 0 284 3 folD Bifunctional protein FolD Edwardsiella ictaluri (strain 93-146)
Q2NV44 2.93e-168 470 78 0 284 3 folD Bifunctional protein FolD Sodalis glossinidius (strain morsitans)
B2VBD1 3.35e-167 468 81 0 280 3 folD Bifunctional protein FolD Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B5FG69 2.68e-157 442 72 0 283 3 folD Bifunctional protein FolD Aliivibrio fischeri (strain MJ11)
Q5E3Y1 2.68e-157 442 72 0 283 3 folD Bifunctional protein FolD Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7MT09 3.72e-155 437 72 0 283 3 folD Bifunctional protein FolD Vibrio campbellii (strain ATCC BAA-1116)
B7VL71 3.95e-153 432 71 0 283 3 folD Bifunctional protein FolD Vibrio atlanticus (strain LGP32)
P51696 2.18e-152 430 72 0 283 1 folD Bifunctional protein FolD Photobacterium phosphoreum
C4K7E4 6.2e-152 429 72 0 281 3 folD Bifunctional protein FolD Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q9KQQ6 6.68e-152 429 69 0 283 3 folD Bifunctional protein FolD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F6V4 6.68e-152 429 69 0 283 3 folD Bifunctional protein FolD Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A0KJD4 9.31e-152 428 71 0 284 3 folD Bifunctional protein FolD Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SNM0 1.76e-151 428 70 0 284 3 folD Bifunctional protein FolD Aeromonas salmonicida (strain A449)
B4RV70 5.49e-150 424 69 0 283 3 folD Bifunctional protein FolD Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q7MIX2 1.11e-149 423 71 0 283 3 folD Bifunctional protein FolD Vibrio vulnificus (strain YJ016)
Q8DB06 1.11e-149 423 71 0 283 3 folD Bifunctional protein FolD Vibrio vulnificus (strain CMCP6)
B6EIM4 1.28e-149 423 72 0 283 3 folD Bifunctional protein FolD Aliivibrio salmonicida (strain LFI1238)
Q6LNV7 1.66e-149 422 70 0 283 3 folD Bifunctional protein FolD Photobacterium profundum (strain SS9)
Q87RB8 2.34e-149 422 71 0 283 3 folD Bifunctional protein FolD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1LTX1 5.67e-149 421 71 0 280 3 folD Bifunctional protein FolD Baumannia cicadellinicola subsp. Homalodisca coagulata
Q5QWH6 5.55e-148 419 69 0 284 3 folD Bifunctional protein FolD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3IF52 1.04e-147 418 69 0 283 3 folD Bifunctional protein FolD Pseudoalteromonas translucida (strain TAC 125)
A4Y5I0 1.54e-147 417 70 0 284 3 folD Bifunctional protein FolD Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1RL91 2.42e-147 417 70 0 284 3 folD Bifunctional protein FolD Shewanella sp. (strain W3-18-1)
Q8EG21 3.4e-147 417 70 0 284 3 folD Bifunctional protein FolD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8H616 6.63e-147 416 71 0 284 3 folD Bifunctional protein FolD Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A9KWH5 8.53e-147 416 70 0 284 3 folD Bifunctional protein FolD Shewanella baltica (strain OS195)
Q0HTK5 2.12e-146 415 70 0 284 3 folD Bifunctional protein FolD Shewanella sp. (strain MR-7)
A6WLP9 3.46e-146 414 69 0 284 3 folD Bifunctional protein FolD Shewanella baltica (strain OS185)
A3D303 3.46e-146 414 69 0 284 3 folD Bifunctional protein FolD Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E5F1 3.46e-146 414 69 0 284 3 folD Bifunctional protein FolD Shewanella baltica (strain OS223)
Q0HH99 3.86e-146 414 70 0 284 3 folD Bifunctional protein FolD Shewanella sp. (strain MR-4)
A0KYM1 3.86e-146 414 70 0 284 3 folD Bifunctional protein FolD Shewanella sp. (strain ANA-3)
B0TLV1 4.31e-146 414 69 0 284 3 folD Bifunctional protein FolD Shewanella halifaxensis (strain HAW-EB4)
B8CRF9 4.34e-146 414 68 0 286 3 folD Bifunctional protein FolD Shewanella piezotolerans (strain WP3 / JCM 13877)
Q12L99 1.53e-145 412 71 0 284 3 folD Bifunctional protein FolD Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
C4LG01 1.57e-145 412 68 0 284 3 folD Bifunctional protein FolD Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A8FTH7 3.13e-145 412 70 0 284 3 folD Bifunctional protein FolD Shewanella sediminis (strain HAW-EB3)
A1S4X3 3.69e-145 412 69 0 284 3 folD Bifunctional protein FolD Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A3QFX8 2.48e-144 409 69 0 284 3 folD Bifunctional protein FolD Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q15R43 7.76e-144 408 68 0 283 3 folD Bifunctional protein FolD Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B1KLT9 9.58e-144 408 67 0 284 3 folD Bifunctional protein FolD Shewanella woodyi (strain ATCC 51908 / MS32)
Q07ZX6 2.21e-143 407 68 0 283 3 folD Bifunctional protein FolD Shewanella frigidimarina (strain NCIMB 400)
A4XTZ3 2.63e-142 404 68 0 283 3 folD1 Bifunctional protein FolD 1 Pseudomonas mendocina (strain ymp)
Q493A0 1.28e-141 403 65 0 283 3 folD Bifunctional protein FolD Blochmanniella pennsylvanica (strain BPEN)
Q87YR0 2.31e-140 399 66 0 284 3 folD1 Bifunctional protein FolD 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZVN1 2.55e-140 399 66 0 284 3 folD1 Bifunctional protein FolD 1 Pseudomonas syringae pv. syringae (strain B728a)
C1DHE7 4.09e-140 399 66 0 283 3 folD Bifunctional protein FolD Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q48KZ8 4.37e-140 399 66 0 284 3 folD1 Bifunctional protein FolD 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q9I2U6 4.56e-140 399 66 0 284 1 folD Bifunctional protein FolD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02KT7 4.56e-140 399 66 0 284 3 folD Bifunctional protein FolD Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VB83 4.56e-140 399 66 0 284 3 folD Bifunctional protein FolD Pseudomonas aeruginosa (strain LESB58)
Q9CJR1 1.94e-139 397 67 1 280 3 folD Bifunctional protein FolD Pasteurella multocida (strain Pm70)
A6V726 1.62e-138 395 66 0 284 3 folD Bifunctional protein FolD Pseudomonas aeruginosa (strain PA7)
A4VL74 1.15e-137 393 66 0 284 3 folD Bifunctional protein FolD Stutzerimonas stutzeri (strain A1501)
Q47XL6 1.74e-137 392 68 0 281 3 folD2 Bifunctional protein FolD 2 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3K9W7 9.6e-137 390 65 0 283 3 folD Bifunctional protein FolD Pseudomonas fluorescens (strain Pf0-1)
B1J675 1.01e-135 388 66 0 283 3 folD Bifunctional protein FolD Pseudomonas putida (strain W619)
B0KJG3 1.09e-135 388 66 0 283 3 folD1 Bifunctional protein FolD 1 Pseudomonas putida (strain GB-1)
A5W638 1.23e-135 387 66 0 283 3 folD Bifunctional protein FolD Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88KM5 1.23e-135 387 66 0 283 3 folD2 Bifunctional protein FolD 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1ICB3 1.51e-135 387 66 0 283 3 folD Bifunctional protein FolD Pseudomonas entomophila (strain L48)
Q4K9J4 2.24e-135 387 65 0 283 3 folD Bifunctional protein FolD Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q65RF1 3.36e-135 386 65 0 280 3 folD Bifunctional protein FolD Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VMD8 2.67e-134 384 63 0 284 3 folD Bifunctional protein FolD Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q8K979 5.68e-134 383 63 0 284 3 folD Bifunctional protein FolD Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B0USU2 8.73e-134 383 65 1 282 3 folD Bifunctional protein FolD Histophilus somni (strain 2336)
Q7VRB3 1.51e-133 383 63 1 283 3 folD Bifunctional protein FolD Blochmanniella floridana
Q0I3S5 2.44e-133 382 64 1 282 3 folD Bifunctional protein FolD Histophilus somni (strain 129Pt)
A1SUX5 2.46e-133 382 68 0 283 3 folD Bifunctional protein FolD Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B8F605 7.46e-132 378 63 1 285 3 folD Bifunctional protein FolD Glaesserella parasuis serovar 5 (strain SH0165)
P44313 1.31e-131 377 64 1 281 3 folD Bifunctional protein FolD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UAS4 1.31e-131 377 64 1 281 3 folD Bifunctional protein FolD Haemophilus influenzae (strain PittEE)
Q4QMI7 1.31e-131 377 64 1 281 3 folD Bifunctional protein FolD Haemophilus influenzae (strain 86-028NP)
Q2SK39 2.33e-131 377 65 0 281 3 folD Bifunctional protein FolD Hahella chejuensis (strain KCTC 2396)
P57557 3.53e-131 376 64 0 284 3 folD Bifunctional protein FolD Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B0BPI2 4.65e-131 376 62 1 280 3 folD Bifunctional protein FolD Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXP3 4.65e-131 376 62 1 280 3 folD Bifunctional protein FolD Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0Q7 8.21e-131 375 62 1 280 3 folD Bifunctional protein FolD Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q1QVV9 4.12e-130 374 63 1 284 3 folD Bifunctional protein FolD Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A5UHL4 1.09e-129 372 62 1 281 3 folD Bifunctional protein FolD Haemophilus influenzae (strain PittGG)
Q3SKX9 1.31e-128 370 64 1 285 3 folD Bifunctional protein FolD Thiobacillus denitrificans (strain ATCC 25259)
A1U1Q5 1.95e-128 369 62 0 283 3 folD Bifunctional protein FolD Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q31FY5 2.1e-127 367 62 1 280 3 folD2 Bifunctional protein FolD 2 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8D2W0 1.92e-126 364 60 0 277 3 folD Bifunctional protein FolD Wigglesworthia glossinidia brevipalpis
Q89A92 1.09e-125 362 58 0 281 3 folD Bifunctional protein FolD Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B8GNT6 9.16e-125 360 62 0 281 3 folD Bifunctional protein FolD Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q7VM86 7.84e-124 358 60 1 283 3 folD Bifunctional protein FolD Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q1GXE6 2.13e-123 357 62 0 280 3 folD Bifunctional protein FolD Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q7NWQ6 4.78e-123 355 61 0 279 3 folD Bifunctional protein FolD Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0AB42 1.79e-122 354 60 0 280 3 folD Bifunctional protein FolD Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q3J8Z0 3.18e-122 353 63 0 284 3 folD Bifunctional protein FolD Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B6J1Z2 6.45e-122 353 59 0 282 3 folD Bifunctional protein FolD Coxiella burnetii (strain CbuG_Q212)
B6J5U6 2.1e-121 351 59 0 282 3 folD Bifunctional protein FolD Coxiella burnetii (strain CbuK_Q154)
Q83EK7 3.33e-121 351 59 0 282 3 folD Bifunctional protein FolD Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NB47 3.33e-121 351 59 0 282 3 folD Bifunctional protein FolD Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KGQ5 3.33e-121 351 59 0 282 3 folD Bifunctional protein FolD Coxiella burnetii (strain Dugway 5J108-111)
A1WUN4 1.26e-120 350 63 0 279 3 folD Bifunctional protein FolD Halorhodospira halophila (strain DSM 244 / SL1)
C1D5X9 2.18e-120 349 60 0 279 3 folD Bifunctional protein FolD Laribacter hongkongensis (strain HLHK9)
B5EJA0 2.42e-115 336 60 0 281 3 folD Bifunctional protein FolD Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JBX9 2.42e-115 336 60 0 281 3 folD Bifunctional protein FolD Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q9JWI9 5.17e-115 335 58 1 284 3 folD Bifunctional protein FolD Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M068 6.09e-115 335 58 1 284 3 folD Bifunctional protein FolD Neisseria meningitidis serogroup C (strain 053442)
P0C277 8.18e-115 335 58 1 284 3 folD Bifunctional protein FolD Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1KWF4 2.28e-114 333 57 1 284 3 folD Bifunctional protein FolD Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q31HQ4 2.47e-114 333 58 0 279 3 folD1 Bifunctional protein FolD 1 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B4RQN5 9.8e-113 329 56 1 284 3 folD Bifunctional protein FolD Neisseria gonorrhoeae (strain NCCP11945)
Q5F5D0 9.8e-113 329 56 1 284 3 folD Bifunctional protein FolD Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q5WX38 1.55e-112 329 54 0 279 3 folD Bifunctional protein FolD Legionella pneumophila (strain Lens)
A5IBF0 1.55e-112 329 54 0 279 3 folD Bifunctional protein FolD Legionella pneumophila (strain Corby)
Q3BSP5 1.79e-112 330 57 1 287 3 folD Bifunctional protein FolD Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5H0S4 2.8e-112 329 58 1 279 3 folD Bifunctional protein FolD Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SLG3 2.8e-112 329 58 1 279 3 folD Bifunctional protein FolD Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P3R1 2.8e-112 329 58 1 279 3 folD Bifunctional protein FolD Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q5X5Q9 7.98e-112 327 53 0 279 3 folD Bifunctional protein FolD Legionella pneumophila (strain Paris)
Q8PK86 9.61e-112 328 57 1 287 3 folD Bifunctional protein FolD Xanthomonas axonopodis pv. citri (strain 306)
Q5ZVZ1 9.83e-112 327 54 0 279 3 folD Bifunctional protein FolD Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q8P8Q4 1.96e-111 327 59 1 276 3 folD Bifunctional protein FolD Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RSB3 1.96e-111 327 59 1 276 3 folD Bifunctional protein FolD Xanthomonas campestris pv. campestris (strain B100)
Q4UVC7 1.96e-111 327 59 1 276 3 folD Bifunctional protein FolD Xanthomonas campestris pv. campestris (strain 8004)
Q9PAR4 6.59e-111 325 57 1 280 3 folD Bifunctional protein FolD Xylella fastidiosa (strain 9a5c)
Q87BK4 1.06e-110 325 57 1 280 3 folD Bifunctional protein FolD Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q057D7 2.77e-105 310 53 1 282 3 folD Bifunctional protein FolD Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A0LE04 7.34e-104 307 53 2 283 3 folD Bifunctional protein FolD Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q2L1G0 1.7e-103 306 55 1 285 3 folD Bifunctional protein FolD Bordetella avium (strain 197N)
Q472L4 2.87e-100 298 54 1 281 3 folD Bifunctional protein FolD Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0KBW5 3.57e-100 298 54 1 281 3 folD Bifunctional protein FolD Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q7M8X1 5.97e-100 297 52 0 281 3 folD Bifunctional protein FolD Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A1AXA0 1.99e-99 295 53 1 276 3 folD Bifunctional protein FolD Ruthia magnifica subsp. Calyptogena magnifica
A5GAM5 2.4e-99 295 52 1 278 3 folD Bifunctional protein FolD Geotalea uraniireducens (strain Rf4)
A5CVZ6 3.36e-99 295 55 1 276 3 folD Bifunctional protein FolD Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B3R4L6 4.43e-99 295 54 1 281 3 folD Bifunctional protein FolD Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B9M769 5.75e-99 294 51 1 278 3 folD Bifunctional protein FolD Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A9ISZ5 9.56e-99 294 55 1 278 3 folD Bifunctional protein FolD Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7WJG1 1.71e-98 293 54 1 280 3 folD Bifunctional protein FolD Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VZC8 1.71e-98 293 54 1 280 3 folD1 Bifunctional protein FolD 1 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WAC0 1.71e-98 293 54 1 280 3 folD1 Bifunctional protein FolD 1 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q2RIB4 6e-98 292 53 1 278 3 folD Bifunctional protein FolD Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q39WH4 1.18e-97 291 52 1 279 3 folD2 Bifunctional protein FolD 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B4EDU1 2.65e-97 290 53 1 280 3 folD Bifunctional protein FolD Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A4JG19 2.86e-97 290 55 1 280 3 folD Bifunctional protein FolD Burkholderia vietnamiensis (strain G4 / LMG 22486)
A9AGS9 3.6e-97 290 54 1 281 3 folD Bifunctional protein FolD Burkholderia multivorans (strain ATCC 17616 / 249)
A7GXK2 8.34e-97 289 52 1 277 3 folD Bifunctional protein FolD Campylobacter curvus (strain 525.92)
B1YT42 1.11e-96 289 54 1 276 3 folD Bifunctional protein FolD Burkholderia ambifaria (strain MC40-6)
Q0BDP0 1.13e-96 289 54 1 276 3 folD Bifunctional protein FolD Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1BHV3 3.8e-96 287 54 1 280 3 folD Bifunctional protein FolD Burkholderia orbicola (strain AU 1054)
A1K589 3.8e-96 288 51 2 284 3 folD Bifunctional protein FolD Azoarcus sp. (strain BH72)
Q63SL6 7.71e-96 286 55 1 276 3 folD Bifunctional protein FolD Burkholderia pseudomallei (strain K96243)
A3NBC0 7.71e-96 286 55 1 276 3 folD Bifunctional protein FolD Burkholderia pseudomallei (strain 668)
Q3JQL8 7.71e-96 286 55 1 276 3 folD Bifunctional protein FolD Burkholderia pseudomallei (strain 1710b)
A4IYR4 1.12e-95 286 51 2 278 3 folD Bifunctional protein FolD Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGF3 1.12e-95 286 51 2 278 1 folD Bifunctional protein FolD Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14HV5 1.12e-95 286 51 2 278 3 folD Bifunctional protein FolD Francisella tularensis subsp. tularensis (strain FSC 198)
Q2SXF8 1.18e-95 286 55 1 276 3 folD Bifunctional protein FolD Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A0Q505 1.43e-95 286 51 2 278 3 folD Bifunctional protein FolD Francisella tularensis subsp. novicida (strain U112)
B9L952 1.67e-95 286 48 1 278 3 folD Bifunctional protein FolD Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A0K8R4 2.7e-95 285 53 1 280 3 folD Bifunctional protein FolD Burkholderia cenocepacia (strain HI2424)
A3NX53 3.11e-95 285 55 1 276 3 folD Bifunctional protein FolD Burkholderia pseudomallei (strain 1106a)
Q30RJ0 3.63e-95 285 48 0 279 3 folD Bifunctional protein FolD Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A1V5P2 4.51e-95 285 55 1 276 3 folD Bifunctional protein FolD Burkholderia mallei (strain SAVP1)
Q62IX5 4.51e-95 285 55 1 276 3 folD Bifunctional protein FolD Burkholderia mallei (strain ATCC 23344)
A2SAQ8 4.51e-95 285 55 1 276 3 folD Bifunctional protein FolD Burkholderia mallei (strain NCTC 10229)
A3MLB7 4.51e-95 285 55 1 276 3 folD Bifunctional protein FolD Burkholderia mallei (strain NCTC 10247)
Q47IX6 5.14e-95 285 51 1 280 3 folD Bifunctional protein FolD Dechloromonas aromatica (strain RCB)
A7I254 5.37e-95 285 51 1 277 3 folD Bifunctional protein FolD Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B1XUA6 6.9e-95 284 52 1 281 3 folD Bifunctional protein FolD Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q1LP48 7.78e-95 284 54 1 280 3 folD Bifunctional protein FolD Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B2UFY4 1.22e-94 284 54 1 276 3 folD Bifunctional protein FolD Ralstonia pickettii (strain 12J)
Q8XZ10 2.24e-94 283 54 1 276 3 folD Bifunctional protein FolD Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A6Q815 2.26e-94 283 49 0 278 3 folD Bifunctional protein FolD Sulfurovum sp. (strain NBC37-1)
B1JV19 2.79e-94 283 53 1 280 3 folD Bifunctional protein FolD Burkholderia orbicola (strain MC0-3)
A4SWT5 5.47e-94 282 53 1 285 3 folD Bifunctional protein FolD Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A3DEE6 5.53e-94 282 50 1 280 3 folD Bifunctional protein FolD Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B2SF67 6.03e-94 281 50 2 278 3 folD Bifunctional protein FolD Francisella tularensis subsp. mediasiatica (strain FSC147)
B0U009 6.88e-94 281 50 2 278 3 folD Bifunctional protein FolD Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q39ES6 8.56e-94 281 54 1 276 3 folD Bifunctional protein FolD Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5N421 1.24e-93 281 49 1 286 3 folD Bifunctional protein FolD Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31Q60 1.24e-93 281 49 1 286 3 folD Bifunctional protein FolD Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B2V9R3 1.61e-93 281 52 3 275 3 folD Bifunctional protein FolD Sulfurihydrogenibium sp. (strain YO3AOP1)
Q5NP22 2.41e-93 281 52 1 287 3 folD Bifunctional protein FolD Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A1AL91 4.02e-93 280 53 1 278 3 folD Bifunctional protein FolD Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A6Q2W6 4.74e-93 280 49 1 278 3 folD Bifunctional protein FolD Nitratiruptor sp. (strain SB155-2)
Q2VYZ7 6.02e-93 280 52 1 285 3 folD Bifunctional protein FolD Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A1VZJ8 1.22e-92 278 51 2 277 3 folD Bifunctional protein FolD Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FLR4 1.22e-92 278 51 2 277 3 folD Bifunctional protein FolD Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B9KLK2 1.93e-92 278 53 3 283 3 folD Bifunctional protein FolD Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q2YC56 2.16e-92 278 48 1 289 3 folD Bifunctional protein FolD Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8FVP6 3.92e-92 278 51 4 287 3 folD Bifunctional protein FolD Brucella suis biovar 1 (strain 1330)
A9WZ75 3.92e-92 278 51 4 287 3 folD Bifunctional protein FolD Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VV73 3.92e-92 278 51 4 287 3 folD Bifunctional protein FolD Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YCL8 3.92e-92 278 51 4 287 3 folD Bifunctional protein FolD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RLT3 3.92e-92 278 51 4 287 3 folD Bifunctional protein FolD Brucella melitensis biotype 2 (strain ATCC 23457)
A9MC67 3.92e-92 278 51 4 287 3 folD Bifunctional protein FolD Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q578R0 3.92e-92 278 51 4 287 3 folD Bifunctional protein FolD Brucella abortus biovar 1 (strain 9-941)
Q2YL33 3.92e-92 278 51 4 287 3 folD Bifunctional protein FolD Brucella abortus (strain 2308)
B2SAP4 3.92e-92 278 51 4 287 3 folD Bifunctional protein FolD Brucella abortus (strain S19)
Q5HUU1 4.05e-92 277 51 2 277 3 folD Bifunctional protein FolD Campylobacter jejuni (strain RM1221)
Q3J049 4.23e-92 278 53 3 283 3 folD Bifunctional protein FolD Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PM50 4.33e-92 277 53 3 283 3 folD Bifunctional protein FolD Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q1GE28 5.38e-92 277 52 2 286 3 folD Bifunctional protein FolD Ruegeria sp. (strain TM1040)
Q2G338 5.68e-92 277 52 2 284 3 folD Bifunctional protein FolD Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B8D2H8 6.69e-92 276 51 4 283 3 folD Bifunctional protein FolD Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q5LNV2 6.99e-92 277 54 4 283 3 folD1 Bifunctional protein FolD 1/3 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A6X610 8.97e-92 277 51 4 287 3 folD Bifunctional protein FolD Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A4IQS0 9.91e-92 276 49 1 281 3 folD Bifunctional protein FolD Geobacillus thermodenitrificans (strain NG80-2)
Q0PA35 1.09e-91 276 51 2 277 1 folD Bifunctional protein FolD Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P54382 1.19e-91 276 49 1 280 1 folD Bifunctional protein FolD Bacillus subtilis (strain 168)
C6BSL6 1.32e-91 276 49 2 283 3 folD Bifunctional protein FolD Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q10X46 1.32e-91 276 50 3 277 3 folD Bifunctional protein FolD Trichodesmium erythraeum (strain IMS101)
Q9LHH7 1.47e-91 276 51 2 287 2 FOLD2 Bifunctional protein FolD 2 Arabidopsis thaliana
Q7VGF6 1.89e-91 275 50 1 274 3 folD Bifunctional protein FolD Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q92BZ4 1.93e-91 275 51 1 277 3 folD Bifunctional protein FolD Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A2SHP8 2.15e-91 275 50 1 281 3 folD Bifunctional protein FolD Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B7KEP3 2.97e-91 275 47 3 285 3 folD Bifunctional protein FolD Gloeothece citriformis (strain PCC 7424)
A4XXZ2 3.21e-91 275 51 2 286 3 folD2 Bifunctional protein FolD 2 Pseudomonas mendocina (strain ymp)
A9GW22 4.27e-91 275 50 1 281 3 folD Bifunctional protein FolD Sorangium cellulosum (strain So ce56)
A4WQ13 5.78e-91 275 52 1 282 3 folD Bifunctional protein FolD Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A0M554 7.84e-91 274 50 3 289 3 folD Bifunctional protein FolD Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A7HDC5 8.12e-91 274 53 2 274 3 folD Bifunctional protein FolD Anaeromyxobacter sp. (strain Fw109-5)
Q3M9M0 8.84e-91 274 48 5 295 3 folD Bifunctional protein FolD Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A7H3N3 1.13e-90 273 51 2 275 3 folD Bifunctional protein FolD Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q167Y9 1.41e-90 274 52 2 286 3 folD1 Bifunctional protein FolD 1 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A7Z6J9 1.65e-90 273 49 1 279 3 folD Bifunctional protein FolD Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A1VN60 2.55e-90 272 51 1 280 3 folD Bifunctional protein FolD Polaromonas naphthalenivorans (strain CJ2)
B7GHF9 2.69e-90 272 48 1 283 3 folD Bifunctional protein FolD Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q55626 3.1e-90 273 46 1 284 3 folD Bifunctional protein FolD Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
C4ZBG7 3.35e-90 272 49 1 276 3 folD Bifunctional protein FolD Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
A8I5P5 5.64e-90 272 51 1 280 3 folD Bifunctional protein FolD Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q989A7 6.27e-90 272 50 4 287 3 folD1 Bifunctional protein FolD 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q13WX0 7.09e-90 271 52 1 276 3 folD Bifunctional protein FolD Paraburkholderia xenovorans (strain LB400)
Q8Z086 7.15e-90 272 46 4 295 3 folD Bifunctional protein FolD Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q2RWY4 7.64e-90 272 52 2 290 3 folD Bifunctional protein FolD Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B8J466 8.36e-90 271 50 2 278 3 folD Bifunctional protein FolD Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B2T5N8 9.42e-90 271 52 1 276 3 folD Bifunctional protein FolD Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q9ZLQ4 1.04e-89 271 48 0 277 3 folD Bifunctional protein FolD Helicobacter pylori (strain J99 / ATCC 700824)
Q71ZW2 1.57e-89 270 49 1 278 3 folD Bifunctional protein FolD Listeria monocytogenes serotype 4b (strain F2365)
Q65HI8 1.77e-89 270 48 1 280 3 folD Bifunctional protein FolD Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8E168 2.43e-89 270 47 0 276 3 folD Bifunctional protein FolD Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E6M3 2.43e-89 270 47 0 276 3 folD Bifunctional protein FolD Streptococcus agalactiae serotype III (strain NEM316)
Q3K2M6 2.43e-89 270 47 0 276 3 folD Bifunctional protein FolD Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q1D7Y2 2.56e-89 270 51 6 285 3 folD2 Bifunctional protein FolD 2 Myxococcus xanthus (strain DK1622)
A4VTM4 3.09e-89 270 48 0 275 3 folD Bifunctional protein FolD Streptococcus suis (strain 05ZYH33)
A7ZCH3 3.37e-89 270 49 1 277 3 folD Bifunctional protein FolD Campylobacter concisus (strain 13826)
Q836W7 3.76e-89 270 46 1 279 3 folD Bifunctional protein FolD Enterococcus faecalis (strain ATCC 700802 / V583)
Q5P922 4.23e-89 270 49 2 284 3 folD Bifunctional protein FolD Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q316P9 4.52e-89 270 49 2 281 3 folD Bifunctional protein FolD Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q74EU7 4.57e-89 269 51 1 278 3 folD2 Bifunctional protein FolD 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8Y7C5 4.62e-89 269 50 1 278 3 folD Bifunctional protein FolD Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A7GSJ9 5.26e-89 269 48 1 280 3 folD Bifunctional protein FolD Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
O67736 5.37e-89 270 50 2 279 3 folD Bifunctional protein FolD Aquifex aeolicus (strain VF5)
B8DFW8 5.5e-89 269 50 1 278 3 folD Bifunctional protein FolD Listeria monocytogenes serotype 4a (strain HCC23)
A0RQ49 6.07e-89 269 51 1 277 3 folD Bifunctional protein FolD Campylobacter fetus subsp. fetus (strain 82-40)
B8I761 6.69e-89 269 47 1 278 3 folD Bifunctional protein FolD Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q1WUJ3 7.14e-89 269 48 1 280 3 folD Bifunctional protein FolD Ligilactobacillus salivarius (strain UCC118)
P56467 1.03e-88 269 47 0 277 3 folD Bifunctional protein FolD Helicobacter pylori (strain ATCC 700392 / 26695)
A4VZV9 1.05e-88 268 48 0 275 3 folD Bifunctional protein FolD Streptococcus suis (strain 98HAH33)
Q160C1 1.12e-88 269 50 2 286 3 folD2 Bifunctional protein FolD 2 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A8ESH8 1.14e-88 268 48 0 276 3 folD Bifunctional protein FolD Aliarcobacter butzleri (strain RM4018)
C1L2R6 1.23e-88 268 49 1 278 3 folD Bifunctional protein FolD Listeria monocytogenes serotype 4b (strain CLIP80459)
A1TPZ6 1.34e-88 268 50 1 281 3 folD Bifunctional protein FolD Paracidovorax citrulli (strain AAC00-1)
Q1CTU9 2.14e-88 268 48 0 277 3 folD Bifunctional protein FolD Helicobacter pylori (strain HPAG1)
A1VGV4 2.17e-88 268 49 2 279 3 folD Bifunctional protein FolD Nitratidesulfovibrio vulgaris (strain DP4)
Q72F91 2.17e-88 268 49 2 279 3 folD Bifunctional protein FolD Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A8FF15 3.01e-88 267 48 1 280 3 folD Bifunctional protein FolD Bacillus pumilus (strain SAFR-032)
Q0BNF1 3.39e-88 267 50 2 278 3 folD Bifunctional protein FolD Francisella tularensis subsp. holarctica (strain OSU18)
Q2A535 3.39e-88 267 50 2 278 3 folD Bifunctional protein FolD Francisella tularensis subsp. holarctica (strain LVS)
A7NA91 3.39e-88 267 50 2 278 3 folD Bifunctional protein FolD Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B9MIU6 8.11e-88 266 50 2 281 3 folD Bifunctional protein FolD Acidovorax ebreus (strain TPSY)
B5YJV1 8.28e-88 266 48 1 280 3 folD Bifunctional protein FolD Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
B9DUU0 9.14e-88 266 47 0 276 3 folD Bifunctional protein FolD Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A1B5A7 9.6e-88 266 51 1 282 3 folD1 Bifunctional protein FolD 1 Paracoccus denitrificans (strain Pd 1222)
A9BWT7 9.86e-88 266 49 2 281 3 folD Bifunctional protein FolD Delftia acidovorans (strain DSM 14801 / SPH-1)
B2J442 1.79e-87 266 47 3 282 3 folD Bifunctional protein FolD Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B3QUL4 1.83e-87 266 46 3 290 3 folD Bifunctional protein FolD Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A3CLQ4 1.94e-87 265 47 0 278 3 folD Bifunctional protein FolD Streptococcus sanguinis (strain SK36)
A8AW32 1.96e-87 265 47 0 278 3 folD Bifunctional protein FolD Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
C4XLR8 2e-87 265 49 1 285 3 folD Bifunctional protein FolD Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B5XM84 2e-87 265 49 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M49 (strain NZ131)
P0DF89 2e-87 265 49 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RDM9 2e-87 265 49 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J5U5 2e-87 265 49 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JG29 2e-87 265 49 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JL04 2e-87 265 49 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JAV4 2e-87 265 49 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q5XB24 2e-87 265 49 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DF88 2e-87 265 49 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
C0ZC05 2.14e-87 265 48 1 281 3 folD Bifunctional protein FolD Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B2A532 2.31e-87 265 48 2 279 3 folD Bifunctional protein FolD Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q75TC1 2.38e-87 265 49 1 281 3 folD Bifunctional protein FolD Geobacillus kaustophilus (strain HTA426)
Q48SM7 2.57e-87 265 49 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q7CN13 2.57e-87 265 49 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99YX2 2.57e-87 265 49 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M1
C5CXD8 3.13e-87 265 49 1 280 3 folD Bifunctional protein FolD Variovorax paradoxus (strain S110)
Q82XC3 3.67e-87 265 50 2 283 3 folD Bifunctional protein FolD Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q9K966 4.29e-87 264 48 2 281 3 folD Bifunctional protein FolD Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q88LI7 4.37e-87 265 50 3 285 3 folD1 Bifunctional protein FolD 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q11M18 4.55e-87 265 49 5 294 3 folD Bifunctional protein FolD Chelativorans sp. (strain BNC1)
A1W7S2 4.84e-87 264 50 2 281 3 folD Bifunctional protein FolD Acidovorax sp. (strain JS42)
Q21D98 5.31e-87 265 48 1 288 3 folD Bifunctional protein FolD Rhodopseudomonas palustris (strain BisB18)
A5VAA8 5.51e-87 265 53 2 284 3 folD3 Bifunctional protein FolD 3 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q4ZUA4 5.84e-87 265 50 3 287 3 folD2 Bifunctional protein FolD 2 Pseudomonas syringae pv. syringae (strain B728a)
Q2JQ25 6.12e-87 264 48 2 293 3 folD Bifunctional protein FolD Synechococcus sp. (strain JA-2-3B'a(2-13))
B7IXH2 7.23e-87 264 47 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain G9842)
Q7VVW3 7.81e-87 264 48 1 281 3 folD2 Bifunctional protein FolD 2 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A5E8S0 9.15e-87 264 48 1 283 3 folD Bifunctional protein FolD Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q73RS2 9.67e-87 264 48 3 291 3 folD Bifunctional protein FolD Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q17W13 1.02e-86 264 46 0 277 3 folD Bifunctional protein FolD Helicobacter acinonychis (strain Sheeba)
Q818R5 1.07e-86 263 47 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q97RI9 1.14e-86 263 48 0 276 3 folD Bifunctional protein FolD Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q07VM6 1.27e-86 263 50 3 289 3 folD Bifunctional protein FolD Rhodopseudomonas palustris (strain BisA53)
A4G352 1.33e-86 263 52 1 280 3 folD Bifunctional protein FolD Herminiimonas arsenicoxydans
A4YK09 1.4e-86 263 48 1 283 3 folD Bifunctional protein FolD Bradyrhizobium sp. (strain ORS 278)
B8HXS0 1.4e-86 263 46 3 282 3 folD Bifunctional protein FolD Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q21WC0 1.62e-86 263 50 1 278 3 folD Bifunctional protein FolD Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A6UB98 1.7e-86 263 48 3 287 3 folD2 Bifunctional protein FolD 2 Sinorhizobium medicae (strain WSM419)
Q635A3 2.22e-86 263 46 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain ZK / E33L)
C0M7V0 2.34e-86 262 48 0 276 3 folD Bifunctional protein FolD Streptococcus equi subsp. equi (strain 4047)
C0MD36 2.91e-86 262 47 0 276 3 folD Bifunctional protein FolD Streptococcus equi subsp. zooepidemicus (strain H70)
A9VGW3 2.98e-86 262 47 1 280 3 folD Bifunctional protein FolD Bacillus mycoides (strain KBAB4)
B9IXH4 2.98e-86 262 46 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain Q1)
B7HNU4 2.98e-86 262 46 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain AH187)
Q6HDY4 3.43e-86 262 46 1 280 3 folD Bifunctional protein FolD Bacillus thuringiensis subsp. konkukian (strain 97-27)
C1ERQ4 3.43e-86 262 46 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain 03BB102)
B7JM32 3.43e-86 262 46 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain AH820)
A0RIH3 3.43e-86 262 46 1 280 3 folD Bifunctional protein FolD Bacillus thuringiensis (strain Al Hakam)
B4U1W4 3.47e-86 262 47 0 276 3 folD Bifunctional protein FolD Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q7W4Z7 3.62e-86 262 48 1 281 3 folD2 Bifunctional protein FolD 2 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
B1WRW8 3.94e-86 262 47 1 285 3 folD Bifunctional protein FolD Crocosphaera subtropica (strain ATCC 51142 / BH68)
A1BBS1 5.31e-86 262 50 2 286 3 folD2 Bifunctional protein FolD 2 Paracoccus denitrificans (strain Pd 1222)
B7HB52 5.36e-86 261 47 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain B4264)
Q731B2 5.78e-86 261 46 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain ATCC 10987 / NRS 248)
Q4L572 6.73e-86 261 47 1 278 3 folD Bifunctional protein FolD Staphylococcus haemolyticus (strain JCSC1435)
A5EX57 7.09e-86 261 51 2 280 3 folD Bifunctional protein FolD Dichelobacter nodosus (strain VCS1703A)
A4XLE0 7.2e-86 261 50 3 272 3 folD Bifunctional protein FolD Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q8EQ43 8.46e-86 261 47 1 274 3 folD Bifunctional protein FolD Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q48HJ1 1.02e-85 261 48 2 284 3 folD2 Bifunctional protein FolD 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q49WI7 1.28e-85 261 47 1 278 3 folD Bifunctional protein FolD Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q030A3 1.34e-85 261 48 1 275 3 folD Bifunctional protein FolD Lactococcus lactis subsp. cremoris (strain SK11)
A2RLU5 1.34e-85 261 48 1 275 3 folD Bifunctional protein FolD Lactococcus lactis subsp. cremoris (strain MG1363)
B1YLQ1 1.72e-85 260 47 2 278 3 folD Bifunctional protein FolD Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q8DQD3 1.94e-85 260 48 0 276 3 folD Bifunctional protein FolD Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04L84 1.94e-85 260 48 0 276 3 folD Bifunctional protein FolD Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A4XY05 2.06e-85 261 51 3 278 3 folD3 Bifunctional protein FolD 3 Pseudomonas mendocina (strain ymp)
Q81M50 2.18e-85 260 46 1 280 3 folD Bifunctional protein FolD Bacillus anthracis
C3LJV5 2.18e-85 260 46 1 280 3 folD Bifunctional protein FolD Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P7W0 2.18e-85 260 46 1 280 3 folD Bifunctional protein FolD Bacillus anthracis (strain A0248)
B1HRX9 2.36e-85 260 49 1 280 3 folD Bifunctional protein FolD Lysinibacillus sphaericus (strain C3-41)
A6SVR5 2.54e-85 260 51 1 280 3 folD Bifunctional protein FolD Janthinobacterium sp. (strain Marseille)
Q2JT84 3.12e-85 260 47 1 284 3 folD Bifunctional protein FolD Synechococcus sp. (strain JA-3-3Ab)
C0R2N7 4.36e-85 259 50 4 281 3 folD Bifunctional protein FolD Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q7NJE8 4.82e-85 259 48 2 286 3 folD Bifunctional protein FolD Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q9CH85 5.05e-85 259 48 1 275 3 folD Bifunctional protein FolD Lactococcus lactis subsp. lactis (strain IL1403)
Q5FST0 5.61e-85 259 50 2 281 3 folD Bifunctional protein FolD Gluconobacter oxydans (strain 621H)
B0KLM9 6.13e-85 259 51 3 280 3 folD2 Bifunctional protein FolD 2 Pseudomonas putida (strain GB-1)
A5FNE3 7.58e-85 259 47 2 285 3 folD Bifunctional protein FolD Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
B8GG34 9.1e-85 258 48 3 284 3 folD Bifunctional protein FolD Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Q2IQE1 1e-84 258 50 2 274 3 folD Bifunctional protein FolD Anaeromyxobacter dehalogenans (strain 2CP-C)
B9DQ45 1.33e-84 258 47 1 278 3 folD Bifunctional protein FolD Staphylococcus carnosus (strain TM300)
Q12A51 1.5e-84 258 50 1 280 3 folD Bifunctional protein FolD Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q2N7E3 1.69e-84 258 48 1 293 3 folD Bifunctional protein FolD Erythrobacter litoralis (strain HTCC2594)
Q0AFN2 2.13e-84 258 47 2 279 3 folD Bifunctional protein FolD Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B3QA91 2.43e-84 258 48 2 288 3 folD Bifunctional protein FolD Rhodopseudomonas palustris (strain TIE-1)
Q6NCQ6 2.43e-84 258 48 2 288 3 folD Bifunctional protein FolD Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q13DA7 4.32e-84 257 49 3 289 3 folD Bifunctional protein FolD Rhodopseudomonas palustris (strain BisB5)
B0C3J3 4.77e-84 257 45 3 286 3 folD Bifunctional protein FolD Acaryochloris marina (strain MBIC 11017)
Q89WX9 5.04e-84 257 49 2 283 3 folD Bifunctional protein FolD Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q2J3Z0 6.98e-84 256 48 3 289 3 folD Bifunctional protein FolD Rhodopseudomonas palustris (strain HaA2)
B0JUP8 8.73e-84 256 46 1 279 3 folD Bifunctional protein FolD Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q6F9E6 8.75e-84 256 50 3 286 3 folD1 Bifunctional protein FolD 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B6IVC0 9.49e-84 256 51 1 288 3 folD Bifunctional protein FolD Rhodospirillum centenum (strain ATCC 51521 / SW)
B7JVV5 9.8e-84 256 46 3 288 3 folD Bifunctional protein FolD Rippkaea orientalis (strain PCC 8801 / RF-1)
A6GZM5 1.06e-83 256 47 3 287 3 folD Bifunctional protein FolD Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q8DVC1 1.16e-83 256 48 0 276 3 folD Bifunctional protein FolD Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9X7F6 1.22e-83 256 47 2 284 3 folD Bifunctional protein FolD Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B4U8W9 1.34e-83 255 48 5 280 3 folD Bifunctional protein FolD Hydrogenobaculum sp. (strain Y04AAS1)
Q8PZQ1 2.15e-83 255 46 1 280 3 folD Bifunctional protein FolD Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q6W210 2.69e-83 255 47 6 295 3 folD Bifunctional protein FolD Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q1GNH1 3.11e-83 255 48 1 285 3 folD Bifunctional protein FolD Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q1II76 3.49e-83 255 45 4 302 3 folD Bifunctional protein FolD Koribacter versatilis (strain Ellin345)
Q46A53 3.55e-83 254 45 1 279 3 folD Bifunctional protein FolD Methanosarcina barkeri (strain Fusaro / DSM 804)
Q73HK3 3.77e-83 254 49 4 281 3 folD Bifunctional protein FolD Wolbachia pipientis wMel
B6JAU5 4.39e-83 254 48 2 283 3 folD Bifunctional protein FolD Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q7UNN9 6.67e-83 254 47 3 295 3 folD Bifunctional protein FolD Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8CPP4 8.12e-83 253 47 1 278 3 folD Bifunctional protein FolD Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q4FNW1 9.38e-83 253 47 1 273 3 folD Bifunctional protein FolD Pelagibacter ubique (strain HTCC1062)
Q6GI21 1.11e-82 253 46 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain MRSA252)
Q5HQA7 1.18e-82 253 47 1 278 3 folD Bifunctional protein FolD Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1DA76 1.22e-82 253 47 4 288 3 folD1 Bifunctional protein FolD 1 Myxococcus xanthus (strain DK1622)
Q2YX11 1.41e-82 253 46 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain bovine RF122 / ET3-1)
A9HEL1 1.83e-82 253 51 2 284 3 folD Bifunctional protein FolD Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A0AIG1 1.88e-82 253 50 1 277 3 folD Bifunctional protein FolD Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B4SGR4 1.97e-82 253 45 3 292 3 folD Bifunctional protein FolD Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q8NX95 2.52e-82 252 46 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain MW2)
A8Z1K5 2.52e-82 252 46 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain USA300 / TCH1516)
Q6GAF0 2.52e-82 252 46 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain MSSA476)
A6QFS2 2.52e-82 252 46 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain Newman)
Q5HH21 2.52e-82 252 46 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain COL)
Q2FZJ6 2.52e-82 252 46 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FI15 2.52e-82 252 46 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain USA300)
Q03RR1 3.02e-82 252 49 2 278 3 folD Bifunctional protein FolD Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q11UD1 3.55e-82 252 45 3 288 3 folD Bifunctional protein FolD Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
B3CLT4 5.01e-82 252 48 2 278 3 folD Bifunctional protein FolD Wolbachia pipientis subsp. Culex pipiens (strain wPip)
A1WJ68 5.16e-82 251 48 1 281 3 folD Bifunctional protein FolD Verminephrobacter eiseniae (strain EF01-2)
B4RE11 6.63e-82 251 47 1 292 3 folD Bifunctional protein FolD Phenylobacterium zucineum (strain HLK1)
Q2GHD8 6.9e-82 251 48 3 287 3 folD Bifunctional protein FolD Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q7A697 6.99e-82 251 45 1 278 1 folD Bifunctional protein FolD Staphylococcus aureus (strain N315)
Q99V34 6.99e-82 251 45 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IRV0 6.99e-82 251 45 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain JH9)
A6U0N1 6.99e-82 251 45 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain JH1)
A7X0V3 6.99e-82 251 45 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain Mu3 / ATCC 700698)
B8DMA9 7.29e-82 251 49 2 276 3 folD Bifunctional protein FolD Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
O65271 8.49e-82 253 46 2 290 1 FOLD4 Bifunctional protein FolD 4, chloroplastic Arabidopsis thaliana
Q3YRE3 9.78e-82 251 48 3 287 3 folD Bifunctional protein FolD Ehrlichia canis (strain Jake)
Q6MAH4 9.96e-82 251 49 5 283 3 folD Bifunctional protein FolD Protochlamydia amoebophila (strain UWE25)
A5G1W5 1.1e-81 250 51 1 279 3 folD Bifunctional protein FolD Acidiphilium cryptum (strain JF-5)
A7HSV9 2.44e-81 250 47 3 289 3 folD Bifunctional protein FolD Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B3EJG9 3.46e-81 250 44 3 292 3 folD Bifunctional protein FolD Chlorobium phaeobacteroides (strain BS1)
A3CWL0 3.51e-81 249 50 0 247 3 folD Bifunctional protein FolD Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
P18155 3.64e-81 251 45 3 299 1 Mthfd2 Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial Mus musculus
Q67NB1 3.65e-81 249 48 2 281 3 folD Bifunctional protein FolD Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q5M583 4.55e-81 249 47 0 277 3 folD Bifunctional protein FolD Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q03LK0 5.13e-81 249 46 0 277 3 folD Bifunctional protein FolD Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
A0B8J7 8.67e-81 248 47 3 276 3 folD Bifunctional protein FolD Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
A1URL6 9.39e-81 249 48 4 285 3 folD Bifunctional protein FolD Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q3SVE4 1.12e-80 248 46 1 283 3 folD Bifunctional protein FolD Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
P96050 1.35e-80 248 46 0 277 3 folD Bifunctional protein FolD Streptococcus thermophilus
Q5M0P7 1.35e-80 248 46 0 277 3 folD Bifunctional protein FolD Streptococcus thermophilus (strain CNRZ 1066)
Q28TR2 1.58e-80 248 47 1 290 3 folD Bifunctional protein FolD Jannaschia sp. (strain CCS1)
Q1QQJ9 1.83e-80 248 47 2 283 3 folD Bifunctional protein FolD Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q5GTK9 1.93e-80 248 48 5 284 3 folD Bifunctional protein FolD Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q88WM8 3.39e-80 247 48 2 279 3 folD Bifunctional protein FolD Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A5V4U1 3.51e-80 247 51 2 288 3 folD1 Bifunctional protein FolD 1 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A5V807 3.99e-80 247 49 3 283 3 folD2 Bifunctional protein FolD 2 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q7MVE9 4.36e-80 247 43 2 289 3 folD Bifunctional protein FolD Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q3AYX2 4.77e-80 247 46 0 281 3 folD Bifunctional protein FolD Synechococcus sp. (strain CC9902)
B9LD23 5.14e-80 246 46 2 279 3 folD Bifunctional protein FolD Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WJ10 5.14e-80 246 46 2 279 3 folD Bifunctional protein FolD Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10620
Feature type CDS
Gene folD
Product bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
Location 2335773 - 2336645 (strand: 1)
Length 873 (nucleotides) / 290 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_981
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00763 Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
PF02882 Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0190 Coenzyme transport and metabolism (H) H 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase

Kegg Ortholog Annotation(s)

Protein Sequence

MSARIIDGKTIAQTIRSEVAEKVKQRIKIGKRAPGLAVILVGDNPASQIYVASKRKACDEVGFISRSYDLPDTTSEADLLNLIDTLNEDNTIDGILVQLPLPAGIDNVKVLERIHPDKDVDGFHPYNIGRLCQRAPKLRPCTPRGIVTLLERCNIPMNGLNAVIIGASNIVGRPMSLELLLAGCTTTVTHRFTKDLRFHVEHADLVVVAVGKPNFIPGEWIKPGAIVIDVGINRLENGKVVGDVDFAQASQRAGWISPVPGGVGPMTVATLIQNTLQACEEYHDPDIGNN

Flanking regions ( +/- flanking 50bp)

TGATCTGACAAAATAGAGCAATACCATAATTGAATAATTTGGATGTATAGATGTCAGCAAGAATTATAGATGGGAAAACGATTGCGCAGACCATCAGAAGTGAAGTGGCAGAAAAAGTAAAACAACGTATTAAGATAGGAAAACGTGCACCGGGTTTAGCGGTTATTTTAGTCGGTGATAACCCTGCATCGCAAATCTATGTTGCTAGTAAACGTAAAGCTTGTGATGAGGTAGGATTTATCTCTCGCTCTTACGATCTACCGGATACTACAAGTGAAGCAGATTTACTCAATCTCATTGATACTCTAAATGAAGATAATACTATTGATGGTATTTTAGTGCAGCTCCCTTTACCTGCGGGAATTGATAACGTCAAAGTATTAGAACGTATTCATCCTGATAAAGATGTTGATGGCTTCCATCCTTACAATATTGGTCGGTTGTGCCAACGTGCACCTAAGCTACGTCCTTGCACCCCTCGTGGTATTGTCACACTCTTAGAGCGTTGCAATATTCCAATGAATGGCTTAAATGCGGTAATTATTGGTGCTTCAAATATTGTTGGTCGCCCAATGAGTTTAGAGCTACTGCTTGCAGGCTGTACAACGACTGTCACTCATCGTTTTACTAAAGACTTACGTTTTCATGTTGAACATGCTGATTTGGTGGTTGTGGCAGTTGGTAAACCTAACTTTATTCCTGGTGAATGGATAAAACCTGGCGCTATTGTCATTGATGTCGGTATTAATCGCCTTGAAAACGGTAAAGTGGTTGGTGATGTTGATTTCGCACAAGCCTCTCAACGCGCGGGGTGGATCTCCCCTGTTCCGGGTGGTGTAGGTCCAATGACTGTAGCGACTTTGATTCAAAATACGTTGCAAGCCTGCGAAGAATATCACGATCCTGATATAGGAAATAATTAATCAATGGAAACATTTCAATTAGATGGTCACCCCTATGTAGAACTGTGTGA