Homologs in group_849

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04295 FBDBKF_04295 46.4 Morganella morganii S1 secM secA translation cis-regulator SecM
EHELCC_05585 EHELCC_05585 46.4 Morganella morganii S2 secM secA translation cis-regulator SecM
NLDBIP_05905 NLDBIP_05905 46.4 Morganella morganii S4 secM secA translation cis-regulator SecM
LHKJJB_02785 LHKJJB_02785 46.4 Morganella morganii S3 secM secA translation cis-regulator SecM
HKOGLL_06260 HKOGLL_06260 46.4 Morganella morganii S5 secM secA translation cis-regulator SecM
F4V73_RS08740 F4V73_RS08740 48.4 Morganella psychrotolerans secM secA translation cis-regulator SecM

Distribution of the homologs in the orthogroup group_849

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_849

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F103 1.48e-128 360 100 0 175 3 secM Secretion monitor Proteus mirabilis (strain HI4320)
Q7N155 5e-46 151 49 5 175 3 secM Secretion monitor Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66EJ7 4.3e-38 131 43 5 179 3 secM Secretion monitor Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FM58 4.3e-38 131 43 5 179 3 secM Secretion monitor Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6D0J1 2.15e-37 129 43 4 174 3 secM Secretion monitor Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4TQ75 7.15e-37 128 43 5 179 3 secM Secretion monitor Yersinia pestis (strain Pestoides F)
Q1CML9 7.15e-37 128 43 5 179 3 secM Secretion monitor Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0S0 7.15e-37 128 43 5 179 3 secM Secretion monitor Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIE1 7.15e-37 128 43 5 179 3 secM Secretion monitor Yersinia pestis
Q1C222 7.15e-37 128 43 5 179 3 secM Secretion monitor Yersinia pestis bv. Antiqua (strain Antiqua)
C6DET5 1.94e-35 124 43 4 174 3 secM Secretion monitor Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VD72 8.81e-33 117 44 7 172 3 secM Secretion monitor Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q32JZ5 3.08e-32 116 38 5 170 3 secM Secretion monitor Shigella dysenteriae serotype 1 (strain Sd197)
A6T4P0 3.79e-32 116 40 5 169 3 secM Secretion monitor Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q3Z5R2 4.4e-32 116 38 5 170 3 secM Secretion monitor Shigella sonnei (strain Ss046)
P62398 4.4e-32 116 38 5 170 3 secM Secretion monitor Shigella flexneri
Q0T8A0 4.4e-32 116 38 5 170 3 secM Secretion monitor Shigella flexneri serotype 5b (strain 8401)
P62395 4.4e-32 116 38 5 170 1 secM Secretion monitor Escherichia coli (strain K12)
B1IR81 4.4e-32 116 38 5 170 3 secM Secretion monitor Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XC74 4.4e-32 116 38 5 170 3 secM Secretion monitor Escherichia coli (strain K12 / DH10B)
C4ZRJ2 4.4e-32 116 38 5 170 3 secM Secretion monitor Escherichia coli (strain K12 / MC4100 / BW2952)
B7M140 4.4e-32 116 38 5 170 3 secM Secretion monitor Escherichia coli O8 (strain IAI1)
B7LFW7 4.4e-32 116 38 5 170 3 secM Secretion monitor Escherichia coli (strain 55989 / EAEC)
B7NHK3 4.6e-32 115 38 5 170 3 secM Secretion monitor Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q1RG98 4.91e-32 115 38 5 170 3 secM Secretion monitor Escherichia coli (strain UTI89 / UPEC)
B7N7X0 4.91e-32 115 38 5 170 3 secM Secretion monitor Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P62396 4.91e-32 115 38 5 170 3 secM Secretion monitor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLP2 4.91e-32 115 38 5 170 3 secM Secretion monitor Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7E2 4.91e-32 115 38 5 170 3 secM Secretion monitor Escherichia coli O1:K1 / APEC
B7MNV6 4.91e-32 115 38 5 170 3 secM Secretion monitor Escherichia coli O81 (strain ED1a)
P62397 4.91e-32 115 38 5 170 3 secM Secretion monitor Escherichia coli O157:H7
B7MAM0 4.91e-32 115 38 5 170 3 secM Secretion monitor Escherichia coli O45:K1 (strain S88 / ExPEC)
A7MQ64 2.24e-31 114 40 5 175 3 secM Secretion monitor Cronobacter sakazakii (strain ATCC BAA-894)
B7UIE7 2.31e-31 114 38 5 170 3 secM Secretion monitor Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q326D8 7.25e-31 112 38 5 170 3 secM Secretion monitor Shigella boydii serotype 4 (strain Sb227)
Q8Z9G4 1.11e-30 112 38 5 169 3 secM Secretion monitor Salmonella typhi
A9MZM6 1.11e-30 112 38 5 169 3 secM Secretion monitor Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PDD0 1.11e-30 112 38 5 169 3 secM Secretion monitor Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57TC3 1.11e-30 112 38 5 169 3 secM Secretion monitor Salmonella choleraesuis (strain SC-B67)
Q8ZRT8 4.53e-30 110 37 5 169 3 secM Secretion monitor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A1JJK1 4.94e-30 110 39 4 180 3 secM Secretion monitor Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8ALJ9 1.92e-29 109 37 5 169 3 secM Secretion monitor Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q2NVU4 6.43e-22 89 39 6 175 3 secM Secretion monitor Sodalis glossinidius (strain morsitans)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10160
Feature type CDS
Gene secM
Product secA translation cis-regulator SecM
Location 2225934 - 2226461 (strand: -1)
Length 528 (nucleotides) / 175 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_849
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06558 Secretion monitor precursor protein (SecM)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K13301 secretion monitor Protein export
Bacterial secretion system		 -

Protein Sequence

MSIINFWRQFGRRYFWSHLLLGMVAAGIGMPSLVSAHAENPSQTDTPSSQNRQSQALIAFDNLFLRQSVQNPASSFTFNYWQQHAVKNVIKQLSFAFTIHSPELMVKAKDEPSPVANVAEVMLDTLYALLTQAPSSTLVNLPISRGVLTENRISYHTGLWLAQIRGIRAGPYLTA

Flanking regions ( +/- flanking 50bp)

CCCGCATAGATTTTGACTCCACAAATTATAAAATTAAATAACGAAGGTTAATGAGCATTATAAATTTTTGGCGACAATTTGGCAGACGATATTTTTGGTCGCATCTGCTATTAGGGATGGTAGCAGCAGGTATTGGTATGCCTTCGCTGGTGTCTGCCCATGCTGAAAATCCATCACAAACGGATACACCTTCCTCACAAAATCGTCAAAGCCAAGCATTAATCGCTTTTGATAATTTATTCTTACGCCAGAGTGTACAGAATCCTGCTTCATCCTTCACCTTTAATTACTGGCAACAGCATGCCGTTAAAAATGTGATTAAGCAGCTCTCTTTTGCTTTTACCATTCATTCACCTGAATTGATGGTAAAAGCAAAAGATGAGCCATCACCTGTTGCGAATGTTGCTGAGGTCATGCTTGATACGCTTTATGCGTTACTGACTCAAGCGCCATCTTCTACCCTAGTTAATTTACCGATTTCCCGTGGCGTGTTAACGGAAAATCGTATTTCCTATCATACCGGATTATGGCTTGCTCAGATCCGTGGTATCCGTGCTGGACCTTACCTAACAGCTTAATTGAGTTTGTTAATCTTTGTTAGATTATGCTTATCTCTATGATTTATCGT