Homologs in group_849

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_05585 EHELCC_05585 100.0 Morganella morganii S2 secM secA translation cis-regulator SecM
NLDBIP_05905 NLDBIP_05905 100.0 Morganella morganii S4 secM secA translation cis-regulator SecM
LHKJJB_02785 LHKJJB_02785 100.0 Morganella morganii S3 secM secA translation cis-regulator SecM
HKOGLL_06260 HKOGLL_06260 100.0 Morganella morganii S5 secM secA translation cis-regulator SecM
F4V73_RS08740 F4V73_RS08740 82.6 Morganella psychrotolerans secM secA translation cis-regulator SecM
PMI_RS10160 PMI_RS10160 46.4 Proteus mirabilis HI4320 secM secA translation cis-regulator SecM

Distribution of the homologs in the orthogroup group_849

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_849

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F103 5.15e-24 94 40 7 162 3 secM Secretion monitor Proteus mirabilis (strain HI4320)
Q7N155 2.35e-21 87 38 3 149 3 secM Secretion monitor Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8ALJ9 5.03e-15 71 34 6 150 3 secM Secretion monitor Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7NHK3 2.17e-13 67 34 7 152 3 secM Secretion monitor Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q1RG98 1.04e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli (strain UTI89 / UPEC)
B7N7X0 1.04e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P62396 1.04e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLP2 1.04e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7E2 1.04e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli O1:K1 / APEC
B7MNV6 1.04e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli O81 (strain ED1a)
P62397 1.04e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli O157:H7
B7MAM0 1.04e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3Z5R2 1.09e-12 65 34 7 152 3 secM Secretion monitor Shigella sonnei (strain Ss046)
P62398 1.09e-12 65 34 7 152 3 secM Secretion monitor Shigella flexneri
Q0T8A0 1.09e-12 65 34 7 152 3 secM Secretion monitor Shigella flexneri serotype 5b (strain 8401)
P62395 1.09e-12 65 34 7 152 1 secM Secretion monitor Escherichia coli (strain K12)
B1IR81 1.09e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XC74 1.09e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli (strain K12 / DH10B)
C4ZRJ2 1.09e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli (strain K12 / MC4100 / BW2952)
B7M140 1.09e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli O8 (strain IAI1)
B7LFW7 1.09e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli (strain 55989 / EAEC)
B7UIE7 1.26e-12 65 34 7 152 3 secM Secretion monitor Escherichia coli O127:H6 (strain E2348/69 / EPEC)
C6DET5 2.41e-12 64 34 7 151 3 secM Secretion monitor Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q66EJ7 3.23e-12 63 33 4 153 3 secM Secretion monitor Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FM58 3.23e-12 63 33 4 153 3 secM Secretion monitor Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TQ75 3.91e-12 63 33 4 153 3 secM Secretion monitor Yersinia pestis (strain Pestoides F)
Q1CML9 3.91e-12 63 33 4 153 3 secM Secretion monitor Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0S0 3.91e-12 63 33 4 153 3 secM Secretion monitor Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIE1 3.91e-12 63 33 4 153 3 secM Secretion monitor Yersinia pestis
Q1C222 3.91e-12 63 33 4 153 3 secM Secretion monitor Yersinia pestis bv. Antiqua (strain Antiqua)
Q32JZ5 7.04e-12 62 33 7 152 3 secM Secretion monitor Shigella dysenteriae serotype 1 (strain Sd197)
Q326D8 7.27e-12 62 33 7 152 3 secM Secretion monitor Shigella boydii serotype 4 (strain Sb227)
Q6D0J1 8.93e-12 62 33 6 151 3 secM Secretion monitor Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8Z9G4 1.09e-11 62 34 6 152 3 secM Secretion monitor Salmonella typhi
A9MZM6 1.09e-11 62 34 6 152 3 secM Secretion monitor Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PDD0 1.09e-11 62 34 6 152 3 secM Secretion monitor Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57TC3 1.09e-11 62 34 6 152 3 secM Secretion monitor Salmonella choleraesuis (strain SC-B67)
A6T4P0 1.62e-11 62 31 6 148 3 secM Secretion monitor Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q8ZRT8 1.71e-11 61 32 3 146 3 secM Secretion monitor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A7MQ64 2.99e-11 61 37 8 151 3 secM Secretion monitor Cronobacter sakazakii (strain ATCC BAA-894)
B2VD72 1.16e-10 59 31 6 148 3 secM Secretion monitor Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1JJK1 6.45e-08 52 30 2 149 3 secM Secretion monitor Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NVU4 2.65e-07 50 36 1 74 3 secM Secretion monitor Sodalis glossinidius (strain morsitans)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_04295
Feature type CDS
Gene secM
Product secA translation cis-regulator SecM
Location 47658 - 48107 (strand: -1)
Length 450 (nucleotides) / 149 (amino acids)

Contig

Accession contig_4
Length 199551 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_849
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06558 Secretion monitor precursor protein (SecM)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K13301 secretion monitor Protein export
Bacterial secretion system		 -

Protein Sequence

MATGFGLPAVLNSGDVTTAGTGTTQNRQSQALSAFDSLFLQSSQPARTSQNVNYWQQHAVRNVIRQISFAFSCPEDASKDNTPAEDRHDASAQNMLAALYAILTDSPALPVYHPAVLPQRIAVVNPSPSFSVQWIARTGGIRAGPVQSA

Flanking regions ( +/- flanking 50bp)

GGCGGCAATTTGGCAGGCGTTATTTCTGGTGCCATCTCTTTATCGGGATTGTGGCGACCGGTTTTGGCCTGCCTGCGGTACTGAACAGTGGTGATGTTACCACAGCCGGTACCGGGACAACACAAAACCGCCAGAGTCAGGCATTATCCGCCTTTGACAGCCTGTTCCTGCAAAGCAGCCAGCCGGCGAGAACCTCACAGAACGTTAATTACTGGCAGCAGCATGCTGTCCGTAATGTTATCCGCCAGATTTCCTTTGCATTTTCCTGTCCGGAAGATGCCTCAAAAGATAATACCCCGGCAGAAGACCGGCATGATGCCTCCGCACAAAATATGCTGGCGGCACTGTATGCCATTCTGACCGACTCCCCGGCTCTGCCTGTTTATCATCCGGCAGTTCTGCCGCAGCGTATTGCTGTAGTTAACCCGTCTCCGTCTTTTTCGGTTCAGTGGATTGCCCGCACCGGCGGCATCCGTGCCGGTCCCGTACAATCAGCGTAGTTCCTCAAAAAAATTATTAACACATTGATTATTAACAAGGCCTGATTGTG