Homologs in group_905

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04215 FBDBKF_04215 56.1 Morganella morganii S1 yacL UPF0231 protein
EHELCC_05505 EHELCC_05505 56.1 Morganella morganii S2 yacL UPF0231 protein
NLDBIP_05825 NLDBIP_05825 56.1 Morganella morganii S4 yacL UPF0231 protein
LHKJJB_02705 LHKJJB_02705 56.1 Morganella morganii S3 yacL UPF0231 protein
HKOGLL_06180 HKOGLL_06180 56.1 Morganella morganii S5 yacL UPF0231 protein
F4V73_RS08660 F4V73_RS08660 55.4 Morganella psychrotolerans - YacL family protein

Distribution of the homologs in the orthogroup group_905

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_905

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F0Y2 1.38e-86 250 100 0 123 3 PMI2039 UPF0231 protein PMI2039 Proteus mirabilis (strain HI4320)
Q7N179 2.53e-53 166 63 0 120 3 plu3616 UPF0231 protein plu3616 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JJM4 2.53e-49 156 62 0 118 3 YE0706 UPF0231 protein YE0706 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DED2 3.51e-48 153 55 0 118 3 PC1_3552 UPF0231 protein PC1_3552 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2K4H8 1.96e-47 151 59 0 117 3 YPTS_0747 UPF0231 protein YPTS_0747 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66EH6 1.96e-47 151 59 0 117 3 YPTB0717 UPF0231 protein YPTB0717 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CLX4 1.96e-47 151 59 0 117 3 YPN_0674 UPF0231 protein YPN_0674 Yersinia pestis bv. Antiqua (strain Nepal516)
B1JK49 1.96e-47 151 59 0 117 3 YPK_3486 UPF0231 protein YPK_3486 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q8ZBJ5 1.96e-47 151 59 0 117 3 YPO3414 UPF0231 protein YPO3414/y0772/YP_0271 Yersinia pestis
A7FM37 1.96e-47 151 59 0 117 3 YpsIP31758_3358 UPF0231 protein YpsIP31758_3358 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TPU1 1.96e-47 151 59 0 117 3 YPDSF_2941 UPF0231 protein YPDSF_2941 Yersinia pestis (strain Pestoides F)
Q1C3U4 1.96e-47 151 59 0 117 3 YPA_2916 UPF0231 protein YPA_2916 Yersinia pestis bv. Antiqua (strain Antiqua)
A9R1H8 1.96e-47 151 59 0 117 3 YpAngola_A1027 UPF0231 protein YpAngola_A1027 Yersinia pestis bv. Antiqua (strain Angola)
Q6D0M1 1.05e-46 149 55 0 118 3 ECA3777 UPF0231 protein ECA3777 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C5B9I5 1.48e-45 146 54 0 120 3 NT01EI_0766 UPF0231 protein NT01EI_0766 Edwardsiella ictaluri (strain 93-146)
B2VD27 2.5e-45 145 52 0 118 3 ETA_08290 UPF0231 protein ETA_08290 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MGP3 5.26e-45 145 52 0 119 3 ESA_03214 UPF0231 protein ESA_03214 Cronobacter sakazakii (strain ATCC BAA-894)
A6T4R4 4.08e-44 142 52 0 117 3 KPN78578_01240 UPF0231 protein KPN78578_01240 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y1R3 9.14e-43 139 52 0 117 3 KPK_4613 UPF0231 protein KPK_4613 Klebsiella pneumoniae (strain 342)
B5BLF5 1.14e-42 139 51 0 117 3 yacL UPF0231 protein YacL Salmonella paratyphi A (strain AKU_12601)
Q5PD96 1.14e-42 139 51 0 117 3 yacL UPF0231 protein YacL Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZRS6 1.61e-42 139 50 0 117 3 yacL UPF0231 protein YacL Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MZQ5 1.61e-42 139 50 0 117 3 yacL UPF0231 protein YacL Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SU84 1.61e-42 139 50 0 117 3 yacL UPF0231 protein YacL Salmonella newport (strain SL254)
B5RH99 1.61e-42 139 50 0 117 3 yacL UPF0231 protein YacL Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2Q9 1.61e-42 139 50 0 117 3 yacL UPF0231 protein YacL Salmonella enteritidis PT4 (strain P125109)
B5FIA8 1.61e-42 139 50 0 117 3 yacL UPF0231 protein YacL Salmonella dublin (strain CT_02021853)
B5F808 1.61e-42 139 50 0 117 3 yacL UPF0231 protein YacL Salmonella agona (strain SL483)
Q8Z9E5 3.75e-42 137 50 0 117 3 yacL UPF0231 protein YacL Salmonella typhi
B4TJC7 5.32e-42 137 49 0 117 3 yacL UPF0231 protein YacL Salmonella heidelberg (strain SL476)
A4W6M4 7.72e-42 137 49 0 117 3 Ent638_0667 UPF0231 protein Ent638_0667 Enterobacter sp. (strain 638)
B4TXL1 1.29e-41 136 49 0 117 3 yacL UPF0231 protein YacL Salmonella schwarzengrund (strain CVM19633)
A8GJ12 2.63e-41 135 57 0 119 3 Spro_4007 UPF0231 protein Spro_4007 Serratia proteamaculans (strain 568)
A8ALH0 1.04e-40 134 49 0 117 3 CKO_03249 UPF0231 protein CKO_03249 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P59396 1.33e-40 134 48 0 117 3 yacL UPF0231 protein YacL Shigella flexneri
Q3Z5P1 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Shigella sonnei (strain Ss046)
B2U2W8 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6HZ94 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli (strain SE11)
B7N7Y9 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8E5 1.34e-40 134 48 0 117 1 yacL UPF0231 protein YacL Escherichia coli (strain K12)
B1IQM1 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZW68 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli O9:H4 (strain HS)
B1XC94 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli (strain K12 / DH10B)
C4ZRL2 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli (strain K12 / MC4100 / BW2952)
B7M160 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli O8 (strain IAI1)
B7NI79 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YZF4 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8E6 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli O157:H7
B7LFY6 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli (strain 55989 / EAEC)
B7MBA2 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIG7 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHK8 1.34e-40 134 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli O139:H28 (strain E24377A / ETEC)
B1LGS0 2.62e-40 133 49 0 117 3 yacL UPF0231 protein YacL Escherichia coli (strain SMS-3-5 / SECEC)
Q0TLL5 2.65e-40 133 49 0 117 3 yacL UPF0231 protein YacL Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FL40 3.44e-40 133 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MNY1 3.44e-40 133 48 0 117 3 yacL UPF0231 protein YacL Escherichia coli O81 (strain ED1a)
B7LVY1 5.1e-40 132 49 0 117 3 yacL UPF0231 protein YacL Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8EAC4 6.3e-29 104 45 3 120 3 SO_3983 UPF0231 protein SO_3983 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8EB82 2.04e-28 103 44 3 120 3 Sbal223_3655 UPF0231 protein Sbal223_3655 Shewanella baltica (strain OS223)
A4Y379 5.28e-28 102 45 3 120 3 Sputcn32_0682 UPF0231 protein Sputcn32_0682 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1S397 7.24e-28 102 40 3 124 3 Sama_0645 UPF0231 protein Sama_0645 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q9CNH4 1.16e-27 101 47 3 118 3 PM0457 UPF0231 protein PM0457 Pasteurella multocida (strain Pm70)
P95509 1.2e-26 99 40 4 122 3 None UPF0231 protein in hemN 3'region Mannheimia haemolytica
A0KSX4 1.94e-26 98 42 3 124 3 Shewana3_0655 UPF0231 protein Shewana3_0655 Shewanella sp. (strain ANA-3)
Q0HRA7 7.92e-26 96 41 3 124 3 Shewmr7_3366 UPF0231 protein Shewmr7_3366 Shewanella sp. (strain MR-7)
Q0HMI1 1.35e-25 96 41 3 124 3 Shewmr4_0656 UPF0231 protein Shewmr4_0656 Shewanella sp. (strain MR-4)
B0BPR0 2.78e-25 95 40 4 121 3 APJL_0987 UPF0231 protein APJL_0987 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXW0 2.78e-25 95 40 4 121 3 APP7_1023 UPF0231 protein APP7_1023 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0X6 6.3e-25 94 40 4 121 3 APL_0968 UPF0231 protein APL_0968 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B5FAN7 9.89e-25 94 40 2 119 3 VFMJ11_2262 UPF0231 protein VFMJ11_2262 Aliivibrio fischeri (strain MJ11)
Q5E2U7 9.89e-25 94 40 2 119 3 VF_2154 UPF0231 protein VF_2154 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7VKZ5 3.26e-24 92 39 4 121 3 HD_1708 UPF0231 protein HD_1708 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6LMI4 4.04e-23 89 42 2 119 3 PBPRA3187 UPF0231 protein PBPRA3187 Photobacterium profundum (strain SS9)
B6EL23 1.36e-22 88 39 2 119 3 VSAL_I2591 UPF0231 protein VSAL_I2591 Aliivibrio salmonicida (strain LFI1238)
P44297 6.09e-22 86 40 4 120 3 HI_1724 UPF0231 protein HI_1724 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KUB7 3.08e-19 80 36 4 127 3 VC_0605 UPF0231 protein VC_0605 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LSL0 3.08e-19 80 36 4 127 3 VCM66_0563 UPF0231 protein VCM66_0563 Vibrio cholerae serotype O1 (strain M66-2)
A5F964 3.08e-19 80 36 4 127 3 VC0395_A0134 UPF0231 protein VC0395_A0134/VC395_0622 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7MYX4 1.08e-17 75 36 3 120 3 VIBHAR_03438 UPF0231 protein VIBHAR_03438 Vibrio campbellii (strain ATCC BAA-1116)
Q7MHW8 6.43e-17 73 36 3 120 3 VV2750 UPF0231 protein VV2750 Vibrio vulnificus (strain YJ016)
Q8DBZ8 6.43e-17 73 36 3 120 3 VV1_1657 UPF0231 protein VV1_1657 Vibrio vulnificus (strain CMCP6)
Q87LW4 2.89e-16 72 34 3 120 3 VP2494 UPF0231 protein VP2494 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10055
Feature type CDS
Gene -
Product YacL family protein
Location 2180690 - 2181061 (strand: -1)
Length 372 (nucleotides) / 123 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_905
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06062 Uncharacterised protein family (UPF0231)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3112 Function unknown (S) S Uncharacterized conserved protein YacL, UPF0231 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09910 uncharacterized protein - -

Protein Sequence

MDYEFQRDLTGGILARFSMDHEAIGYWLNDEIQGDISLIDQILTEMDEVKGSEKQWQLIGKEYSLSIDDEEIMVRANTLHFETDDLEEGMSYYDNESIAFCGLDDFATMLQKYRLFILENRRS

Flanking regions ( +/- flanking 50bp)

TAGATATTTTATATAGAAAAAGGCGACAGCTAATTTAAGGGGCATACACCATGGACTATGAATTTCAGCGTGATCTTACTGGCGGTATATTGGCCCGTTTTTCAATGGATCATGAGGCGATTGGTTATTGGTTAAATGATGAGATCCAAGGTGATATCAGCTTAATCGATCAAATTTTGACTGAGATGGACGAAGTTAAAGGCAGTGAGAAACAGTGGCAATTGATTGGTAAAGAATACAGCTTATCTATTGATGATGAGGAAATTATGGTAAGGGCGAATACTCTCCATTTTGAAACCGATGATTTAGAAGAAGGGATGAGCTACTACGATAATGAAAGCATCGCATTTTGTGGATTAGATGATTTTGCTACTATGCTACAAAAATATCGGTTATTTATTCTGGAAAATAGAAGAAGTTAACAAATCCCATATATTTATTAAATAAATCTGCCACAATATACTATTGGTTG