Homologs in group_835

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04210 FBDBKF_04210 70.4 Morganella morganii S1 mscS Small-conductance mechanosensitive channel
EHELCC_05500 EHELCC_05500 70.4 Morganella morganii S2 mscS Small-conductance mechanosensitive channel
NLDBIP_05820 NLDBIP_05820 70.4 Morganella morganii S4 mscS Small-conductance mechanosensitive channel
LHKJJB_02700 LHKJJB_02700 70.4 Morganella morganii S3 mscS Small-conductance mechanosensitive channel
HKOGLL_06175 HKOGLL_06175 70.4 Morganella morganii S5 mscS Small-conductance mechanosensitive channel
F4V73_RS08655 F4V73_RS08655 68.0 Morganella psychrotolerans mscS small-conductance mechanosensitive channel MscS

Distribution of the homologs in the orthogroup group_835

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_835

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O52401 7.72e-134 383 68 1 280 3 mscS Small-conductance mechanosensitive channel Edwardsiella ictaluri (strain 93-146)
P0C0S3 5.03e-118 343 61 0 273 3 mscS Small-conductance mechanosensitive channel Shigella flexneri
P0C0S1 5.03e-118 343 61 0 273 1 mscS Small-conductance mechanosensitive channel Escherichia coli (strain K12)
P0C0S2 5.03e-118 343 61 0 273 3 mscS Small-conductance mechanosensitive channel Escherichia coli O157:H7
Q8K9B1 1.35e-111 326 54 1 281 3 BUsg_437 Uncharacterized MscS family protein BUsg_437 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57527 6.39e-111 325 52 1 281 3 BU452 Uncharacterized MscS family protein BU452 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AB5 2.03e-101 300 53 0 270 3 bbp_402 Uncharacterized MscS family protein bbp_402 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P0DKS1 2.71e-66 211 40 1 279 3 mscS Small-conductance mechanosensitive channel Wigglesworthia glossinidia brevipalpis
Q55717 1.73e-63 204 38 0 260 3 slr0639 Uncharacterized MscS family protein slr0639 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
T0DVE4 1.17e-36 134 32 2 259 1 mscS Small-conductance mechanosensitive channel Helicobacter pylori (strain UM084)
O28726 1.05e-27 111 29 1 234 3 AF_1546 Uncharacterized MscS family protein AF_1546 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P77338 4.13e-23 102 28 2 212 1 mscK Mechanosensitive channel MscK Escherichia coli (strain K12)
O66994 3.58e-22 97 25 4 207 3 aq_812 Uncharacterized MscS family protein aq_812 Aquifex aeolicus (strain VF5)
Q8R6L9 1.31e-19 89 25 8 271 1 mscS Small-conductance mechanosensitive channel Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
O25170 1.92e-18 88 22 5 295 3 HP_0415 Uncharacterized MscS family protein HP_0415 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZKG7 2.25e-18 88 23 4 258 3 jhp_0969 Uncharacterized MscS family protein jhp_0969 Helicobacter pylori (strain J99 / ATCC 700824)
O07594 5.12e-17 83 24 5 231 3 yhdY Uncharacterized MscS family protein YhdY Bacillus subtilis (strain 168)
Q57634 1.28e-16 82 29 6 234 1 MJ0170 Small-conductance mechanosensitive channel MscMJ Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q57362 3.19e-16 82 25 6 259 1 HI_0195.1 Uncharacterized MscS family protein HI_0195.1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q58543 7.73e-16 80 27 7 273 1 MJ1143 Large-conductance mechanosensitive channel MscMJLR Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P0AEB5 1.11e-15 79 24 6 250 1 ynaI Low conductance mechanosensitive channel YnaI Escherichia coli (strain K12)
P0AEB6 1.11e-15 79 24 6 250 3 ynaI Low conductance mechanosensitive channel YnaI Escherichia coli O157:H7
O34897 7.64e-13 70 26 6 252 2 ykuT Uncharacterized MscS family protein YkuT Bacillus subtilis (strain 168)
P39285 2.27e-11 67 21 3 225 1 mscM Miniconductance mechanosensitive channel MscM Escherichia coli (strain K12)
Q8VZL4 1.59e-09 61 25 2 194 1 MSL1 Mechanosensitive ion channel protein 1, mitochondrial Arabidopsis thaliana
Q58111 3.69e-07 54 24 4 174 3 MJ0700 Uncharacterized MscS family protein MJ0700 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O35043 1.26e-05 49 22 5 189 2 yfkC Uncharacterized MscS family protein YfkC Bacillus subtilis (strain 168)
Q84M97 4.21e-05 48 21 2 134 1 MSL9 Mechanosensitive ion channel protein 9 Arabidopsis thaliana
Q56X46 0.000318 45 27 5 146 2 MSL2 Mechanosensitive ion channel protein 2, chloroplastic Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10050
Feature type CDS
Gene mscS
Product small-conductance mechanosensitive channel MscS
Location 2179738 - 2180598 (strand: -1)
Length 861 (nucleotides) / 286 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_835
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00924 Mechanosensitive ion channel, beta-domain
PF05552 Mechanosensitive ion channel, conserved TM helix
PF21082 Mechanosensitive ion channel MscS, C-terminal
PF21088 Mechanosensitive ion channel, transmembrane helices 2/3

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0668 Cell wall/membrane/envelope biogenesis (M) M Small-conductance mechanosensitive channel

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03442 small conductance mechanosensitive channel - -

Protein Sequence

MNELPASLDEATGWFVANQELFIQYAVNIVAAFLILFIGLFVAKMVSKGVARILTLRHIDATVVTFLSVLVRYTVIAFTLIAVLGRLGVQTASVIAVLGAAGLAVGLALQGSLSNFAAGVLIVIFRPIRAGEYVMIGAVEGTVRDVQIFSTTLRSADDRIIVIPNSKIISSEVINLSREPNRRTQIIVGVAYDADIDKVKQVLGDVVAQDKRIQHNQGVTIRLHEMAPSSLNFVVRVWTTNDDAWPVYWDLMENFKRALDANNIGIPFPQMDVYMHQAQNTVMKAE

Flanking regions ( +/- flanking 50bp)

TATTGGTTGCTATTCTTTTTATTAGGATTATAAGTTTAAAAGGTGGTCTAATGAATGAATTACCTGCGAGTTTAGATGAAGCAACAGGTTGGTTTGTTGCTAATCAAGAACTCTTTATTCAATATGCTGTGAATATCGTTGCTGCATTCTTGATCCTATTTATTGGTCTTTTTGTCGCTAAAATGGTCAGTAAAGGGGTTGCACGAATTTTAACGTTACGCCATATCGACGCAACTGTTGTGACATTCTTGTCTGTCTTGGTGCGTTATACCGTTATTGCATTCACTTTGATTGCAGTATTAGGTCGATTAGGGGTTCAAACAGCTTCTGTTATCGCAGTACTTGGTGCGGCAGGTTTAGCGGTTGGTTTAGCATTACAAGGCTCACTCTCTAACTTTGCAGCGGGTGTTTTAATTGTTATCTTCCGTCCTATTCGTGCTGGTGAATACGTGATGATTGGTGCTGTCGAAGGTACGGTGCGAGATGTACAAATATTCTCGACCACATTACGTTCAGCGGATGACCGGATCATTGTTATTCCAAATAGCAAAATTATCAGTAGTGAGGTTATTAACCTTAGCCGTGAGCCAAATCGTCGTACACAAATTATTGTCGGCGTTGCTTATGATGCTGATATTGATAAAGTCAAACAAGTGCTCGGTGATGTTGTTGCGCAAGATAAACGTATTCAACATAACCAAGGCGTGACAATACGTTTACATGAAATGGCGCCTTCTTCATTAAACTTTGTGGTACGTGTTTGGACCACCAATGATGATGCATGGCCAGTTTATTGGGATCTTATGGAAAACTTTAAACGCGCGCTAGATGCAAATAATATTGGTATTCCATTCCCACAAATGGATGTCTATATGCATCAAGCACAAAATACCGTGATGAAAGCAGAATAAGCACTATTGTTATAAAACACATCTCAAGAGCCACCGATTAAGCGTGGCTC