Homologs in group_2900

Help

5 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12820 FBDBKF_12820 33.1 Morganella morganii S1 - lysis protein
PMI_RS02445 PMI_RS02445 35.2 Proteus mirabilis HI4320 - lysis protein
PMI_RS04515 PMI_RS04515 35.9 Proteus mirabilis HI4320 - lysis protein
PMI_RS04715 PMI_RS04715 36.3 Proteus mirabilis HI4320 - lysis protein
PMI_RS08435 PMI_RS08435 29.1 Proteus mirabilis HI4320 - lysis system i-spanin subunit Rz

Distribution of the homologs in the orthogroup group_2900

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2900

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77551 1.27e-10 58 38 1 90 5 rzpR Putative endopeptidase RzpR Escherichia coli (strain K12)
P13583 2.26e-10 58 38 1 89 3 15 Spanin, inner membrane subunit Salmonella phage P22
P00726 4.52e-10 58 38 1 90 1 Rz Spanin, inner membrane subunit Escherichia phage lambda
P27358 4.91e-10 58 32 5 153 3 Rz Spanin, inner membrane subunit Enterobacteria phage P21
P75719 7.29e-10 57 38 1 90 3 rzpD Prophage Rz endopeptidase RzpD Escherichia coli (strain K12)
Q9XJJ6 2.88e-08 53 33 0 90 3 Rz Spanin, inner membrane subunit Escherichia phage 933W

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09785
Feature type CDS
Gene -
Product lysis protein
Location 2130265 - 2130768 (strand: -1)
Length 504 (nucleotides) / 167 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2900
Orthogroup size 6
N. genomes 2

Actions

Genomic region

Domains

PF03245 Bacteriophage Rz lysis protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K14744 prophage endopeptidase [EC:3.4.-.-] - -

Protein Sequence

MKRNVLLIIVAGVMGLLLIFKFDALLTENSQLKGDNLALKKSVISHQDAIEHYQEELARLSELDKQHTKALTDAKNDISRLNDELRNNTKRVYIKADCPNPDNHTTATAGMGNATSARLTETAQQDYLRLLEMMAENKAQTEYLIDYINRLLQYINELNHEKACKPA

Flanking regions ( +/- flanking 50bp)

TTACCCGTTGAAACCCGCTTTCCTGATTATCCTCATATTGAGATCCCACGATGAAAAGGAACGTACTGCTGATTATTGTGGCGGGTGTGATGGGCTTGCTACTGATATTTAAGTTTGATGCTTTGCTCACTGAGAATAGCCAGCTTAAGGGTGATAATCTCGCCCTTAAGAAAAGTGTTATCAGTCATCAAGACGCCATTGAACATTATCAGGAAGAACTTGCCCGCTTATCAGAATTGGATAAACAACACACAAAGGCGTTAACCGATGCAAAAAATGATATTAGCCGGCTTAATGATGAGTTGCGCAATAATACTAAACGGGTGTACATCAAAGCCGATTGCCCCAACCCCGATAATCACACCACCGCCACCGCCGGCATGGGTAATGCAACCTCCGCACGACTTACCGAAACAGCTCAACAAGATTATTTACGTCTCCTCGAAATGATGGCGGAGAATAAGGCACAAACAGAATATTTGATTGATTATATAAACCGATTATTGCAATACATCAATGAGTTAAACCATGAAAAAGCCTGCAAACCTGCGTGATGCATTAATTAAAAAGGTAAGCTATTTAGGGGATAACCCCGATAGGCTCT