Homologs in group_3898

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS11880 PMI_RS11880 30.4 Proteus mirabilis HI4320 - ogr/Delta-like zinc finger family protein

Distribution of the homologs in the orthogroup group_3898

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3898

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P08762 2.88e-21 81 50 0 72 4 ogr Late control protein ogr Escherichia phage P2
P37057 4.52e-21 80 50 0 72 4 ogrK Prophage late control protein OgrK Escherichia coli (strain K12)
P08711 4.47e-19 75 48 0 72 4 B Late control gene B protein Escherichia phage 186
P12551 6.57e-07 47 46 0 45 4 Delta Transactivation protein Enterobacteria phage P4
P12551 7.46e-05 41 33 1 59 4 Delta Transactivation protein Enterobacteria phage P4

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09715
Feature type CDS
Gene -
Product ogr/Delta-like zinc finger family protein
Location 2118115 - 2118333 (strand: -1)
Length 219 (nucleotides) / 72 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3898
Orthogroup size 2
N. genomes 1

Actions

Genomic region

Domains

PF04606 Ogr/Delta-like zinc finger

Protein Sequence

MMICPVCGHAAHTRSSQQISSDTKERYNQCQNINCGATFVSHETVTRFISKPQLIERVEPHVDKCCQQALAI

Flanking regions ( +/- flanking 50bp)

CCTGTGTATAATTACAGGTAATTTCCACATCATAAAGAGGTAACCCGTTTATGATGATTTGTCCTGTTTGTGGTCATGCCGCCCATACCCGTAGTAGTCAACAAATATCTTCCGATACCAAAGAACGTTATAACCAGTGCCAGAATATCAATTGTGGTGCGACGTTCGTGAGTCATGAAACCGTAACGCGGTTTATTTCAAAGCCTCAGTTGATTGAACGGGTAGAGCCGCATGTAGATAAGTGTTGCCAACAGGCATTAGCGATTTGAGGAAAATGCCCGGAGTATTCCGGGCGTTGTTTTATTTATTTGCCGTTAAT